Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
Funding $60,586.4
PubMed Score 22.94
PubTator Score 10.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60245 O60246 O60247 Q4W5C4
Symbols BHPCDH
BH-Pcdh
PPP1R120

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

2YST  

 GO Function (1)

Gene RIF (6)

PMID Text
25446128 Pcdh7 plays a key role in osteoclastogenesis by promoting cell-cell fusion
24614497 Two SNPs rs13146789 and rs13109270 of PCDH7 showed strong association with musical aptitude and inner ear development and neurocognitive functions.
23751349 PCDH7 is up-regulation in bone metastatic breast cancer tissues.
23369722 Methylation of polycomb groups target genes is an early event in urothelial carcinogenesis in young patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414679 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLES      1 - 70
GSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNT     71 - 140
PTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELLQEPGGGGSGGESRRAGAADSAPYPGGG    141 - 210
GNGASGGGSGGSKRRLDASEGGGGTNPGGRSSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRV    211 - 280
RDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAA    281 - 350
TESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKI    351 - 420
GRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTS    421 - 490
TPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLAT    491 - 560
DADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVA    561 - 630
DKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSF    631 - 700
DREHQTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATD    701 - 770
SDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVN    771 - 840
ESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNKN    841 - 910
GYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPNGQRYDSVNEKLSDSPSMGRY    911 - 980
RSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDLPPANTFVGAGDNISIGSDHCSEYSCQ    981 - 1050
TNNKYSKQMRLHPYITVFG                                                      1051 - 1069
//

Text Mined References (27)

PMID Year Title
25446128 2014 Global epigenomic analysis indicates protocadherin-7 activates osteoclastogenesis by promoting cell-cell fusion.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
24614497 2015 A genome-wide linkage and association study of musical aptitude identifies loci containing genes related to inner ear development and neurocognitive functions.
23751349 2013 Protocadherin-7 induces bone metastasis of breast cancer.
23369722 2013 Hypermethylation of the polycomb group target gene PCDH7 in bladder tumors from patients of all ages.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...