Property Summary

NCBI Gene PubMed Count 25
PubMed Score 26.34
PubTator Score 10.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 0.9
Multiple Sclerosis 540 0.0 2.9
Orofacial cleft 54 0.0 1.3
Disease Target Count Z-score Confidence
Idiopathic generalized epilepsy 14 3.107 1.6

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease 1.050 3.6e-02
adult high grade glioma -1.900 1.3e-03
aldosterone-producing adenoma -1.158 6.2e-03
astrocytoma -1.600 1.1e-08
Astrocytoma, Pilocytic 1.300 2.5e-06
atypical teratoid / rhabdoid tumor 2.900 7.4e-04
Breast cancer -2.400 1.8e-07
chronic rhinosinusitis -1.334 3.5e-02
colon cancer -1.500 1.4e-02
cutaneous lupus erythematosus -1.600 7.7e-05
cystic fibrosis and chronic rhinosinusit... -1.116 2.4e-02
Duchenne muscular dystrophy 1.043 2.9e-07
ependymoma -1.500 3.5e-05
glioblastoma -1.100 6.8e-03
group 3 medulloblastoma -1.600 4.9e-02
head and neck cancer -1.400 4.7e-02
intraductal papillary-mucinous neoplasm ... 3.300 5.2e-04
invasive ductal carcinoma 1.500 1.6e-02
lung adenocarcinoma 1.500 4.2e-04
malignant mesothelioma -2.800 7.1e-09
medulloblastoma, large-cell -2.300 2.9e-03
non diabetic and post-ischemic heart fai... -1.400 4.7e-03
non-small cell lung cancer 2.018 4.2e-13
oligodendroglioma -1.400 1.8e-06
osteosarcoma 1.434 3.1e-02
ovarian cancer 1.900 6.5e-04
pancreatic cancer 1.800 3.4e-05
pancreatic ductal adenocarcinoma liver m... 1.102 3.0e-02
primitive neuroectodermal tumor -1.600 3.7e-02
psoriasis -2.000 1.4e-04
type II diabetes mellitus and post-ische... -1.400 1.2e-02
ulcerative colitis 1.600 2.0e-02

 GO Function (1)

Gene RIF (9)

AA Sequence

MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLES      1 - 70
GSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQVIVLDINDNT     71 - 140
PTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERYELLQEPGGGGSGGESRRAGAADSAPYPGGG    141 - 210
GNGASGGGSGGSKRRLDASEGGGGTNPGGRSSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRV    211 - 280
RDGGDPPRSSQAILRVLITDVNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAA    281 - 350
TESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKI    351 - 420
GRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQNKKKYFLHTS    421 - 490
TPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVVEVYFPENNIPGERVATVLAT    491 - 560
DADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVA    561 - 630
DKNDNDPKFMQDVFTFYVKENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSF    631 - 700
DREHQTTYTFRVKAVDGGDPPRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATD    701 - 770
SDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVN    771 - 840
ESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVMARYCRSKNKN    841 - 910
GYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPNGQRYDSVNEKLSDSPSMGRY    911 - 980
RSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQAVQDLPPANTFVGAGDNISIGSDHCSEYSCQ    981 - 1050
TNNKYSKQMRLHPYITVFG                                                      1051 - 1069
//

Text Mined References (30)

PMID Year Title