Property Summary

NCBI Gene PubMed Count 34
PubMed Score 43.79
PubTator Score 18.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.800 5.6e-06
astrocytic glioma -1.100 1.8e-02
Astrocytoma, Pilocytic 1.200 6.3e-05
atypical teratoid / rhabdoid tumor 1.500 6.7e-08
ependymoma 1.100 1.6e-02
glioblastoma 1.200 1.6e-07
group 3 medulloblastoma 1.300 3.2e-03
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
intraductal papillary-mucinous carcinoma... 1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.600 5.2e-03
lung adenocarcinoma 1.003 7.0e-08
medulloblastoma, large-cell 1.100 8.4e-05
osteosarcoma 1.224 2.8e-03
ovarian cancer -2.000 2.2e-07
primitive neuroectodermal tumor 1.200 7.6e-04
psoriasis 1.200 7.0e-04
subependymal giant cell astrocytoma -1.124 3.2e-02
tuberculosis -1.700 2.2e-09

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLT      1 - 70
DLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLA     71 - 140
RDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPP    141 - 210
QLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQS    211 - 280
RLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTG    281 - 350
TASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAIL    351 - 420
RGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRII    421 - 490
PWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNK    491 - 560
PTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKR    561 - 630
AGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKA    631 - 700
LDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDW    701 - 770
NSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGP    771 - 840
NSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQS    841 - 910
STHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNE    911 - 980
DDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAA    981 - 1050
SSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSP   1051 - 1120
AARMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSP   1121 - 1190
TPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQT   1191 - 1260
LQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQAT   1261 - 1330
QLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQAD   1331 - 1400
IPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP                   1401 - 1454
//

Text Mined References (46)

PMID Year Title