Property Summary

NCBI Gene PubMed Count 34
Grant Count 13
R01 Count 10
Funding $883,467.75
PubMed Score 43.10
PubTator Score 18.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25383669 This results from a dramatically enhanced ability of MED14-containing complexes to associate with Pol II.
25100719 SiRNA knockdown of MED14 shows a significant inhibition in HIV-1 Tat-mediated transcription levels as compared to control
25100719 Knockdown of mediator complex subunit 14 (MED14) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
23572530 VitD-mediated stimulation of GC anti-inflammatory affects human monocytes in a process involving GM-CSF and MED14
18976975 SiRNA knockdown of MED14 shows a significant inhibition in HIV-1 Tat-mediated transcription levels as compared to control
18854154 Knockdown of mediator complex subunit 14 (MED14) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 SiRNA knockdown of MED14 shows a significant inhibition in HIV-1 Tat-mediated transcription levels as compared to control
18187620 Knockdown of mediator complex subunit 14 (MED14) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17306756 Coactivator that enhances estrogen receptor alpha- and specificity protein (SP)-1-mediated transactivation in breast cancer cells.
16239257 MED14 and MED1 are used by glucocorticoid receptor in a gene-specific manner, providing a mechanism for promoter selectivity by glucocorticoid receptor
More...

AA Sequence

MAPVQLENHQLVPPGGGGGGSGGPPSAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLT      1 - 70
DLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLA     71 - 140
RDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPP    141 - 210
QLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQS    211 - 280
RLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTG    281 - 350
TASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAIL    351 - 420
RGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRII    421 - 490
PWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNK    491 - 560
PTQLSYKYYFMSVNAADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVESKKTKR    561 - 630
AGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGITEETQKA    631 - 700
LDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDW    701 - 770
NSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGP    771 - 840
NSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQS    841 - 910
STHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNE    911 - 980
DDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAA    981 - 1050
SSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSP   1051 - 1120
AARMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSP   1121 - 1190
TPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQT   1191 - 1260
LQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQAT   1261 - 1330
QLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQAD   1331 - 1400
IPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP                   1401 - 1454
//

Text Mined References (46)

PMID Year Title
25383669 2014 Reconstitution of active human core Mediator complex reveals a critical role of the MED14 subunit.
24952135 2014 RNA-Seq for the identification of novel Mediator transcripts in endothelial progenitor cells.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
23572530 2013 Vitamin D enhances glucocorticoid action in human monocytes: involvement of granulocyte-macrophage colony-stimulating factor and mediator complex subunit 14.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...