Property Summary

NCBI Gene PubMed Count 17
Grant Count 1
Funding $195,000
PubMed Score 17.45
PubTator Score 15.15

Knowledge Summary

Patent (2,619)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.200 0.000
glioblastoma multiforme -1.200 0.000
oligodendroglioma -1.300 0.000
ependymoma -1.100 0.000
medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -3.000 0.000
primitive neuroectodermal tumor -1.500 0.001
active Crohn's disease 1.031 0.011
adult high grade glioma -1.500 0.001
Breast cancer 1.200 0.000
pituitary cancer 2.000 0.000

Synonym

Accession O60241 B9EGK9 Q5T6K0 Q8NGW8 Q96GZ9
Symbols BAI2

Gene

 Grant Application (1)

Gene RIF (4)

PMID Text
21787750 This is the first study reporting BAI2 as an interaction partner of GIP.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20367554 BAI2 is a functional GPCR regulated by proteolytic processing and activates the NFAT pathway
12218411 involvement of BAI2 in the ischemia-induced brain angiogenesis

AA Sequence

MENTGWMGKGHRMTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLE      1 - 70
NPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQAESEVGRPEEEEAEAAAGLE     71 - 140
LCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGR    141 - 210
AAGRACGFAQPGCSCPGEAGAGSTTTTSPGPPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYG    211 - 280
EEPEEEPKVKTQWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLR    281 - 350
ETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG    351 - 420
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKT    421 - 490
CDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKCPPN    491 - 560
ASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRT    561 - 630
YYSGDLLFSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVED    631 - 700
FIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSS    701 - 770
PGKPATSGAAGSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR    771 - 840
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQAAHTRCQCQH    841 - 910
LSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASN    911 - 980
ILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVV    981 - 1050
AVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSE   1051 - 1120
RCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVF   1121 - 1190
NSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVN   1191 - 1260
TCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEG   1261 - 1330
GLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGGGGGGGEDAPRARPEGTPRRAAKTVAHTEGYPSFLS   1331 - 1400
VDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKMGSLERKKLRYSDLD   1401 - 1470
FEKVMHTRKRHSELYHELNQKFHTFDRYRSQSTAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRR   1471 - 1540
HQSWSTFKSMTLGSLPPKPRERLTLHRAAAWEPTEPPDGDFQTEV                            1541 - 1585
//

Text Mined References (18)

PMID Year Title
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
21787750 2011 Identification of brain-specific angiogenesis inhibitor 2 as an interaction partner of glutaminase interacting protein.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20367554 2010 Brain-specific angiogenesis inhibitor 2 (BAI2) may be activated by proteolytic processing.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16412436 2006 Brain-specific angiogenesis inhibitor 2 regulates VEGF through GABP that acts as a transcriptional repressor.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225653 2004 Expression of brain-specific angiogenesis inhibitor 3 (BAI3) in normal brain and implications for BAI3 in ischemia-induced brain angiogenesis and malignant glioma.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
More...