Property Summary

NCBI Gene PubMed Count 18
PubMed Score 21.22
PubTator Score 15.15

Knowledge Summary

Patent (2,619)

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.031 1.1e-02
adult high grade glioma -1.500 6.7e-04
astrocytoma -1.200 1.2e-19
atypical teratoid / rhabdoid tumor -1.500 6.5e-05
Breast cancer 1.200 1.9e-06
ependymoma -1.100 7.2e-05
glioblastoma -1.100 3.1e-04
group 3 medulloblastoma -1.400 6.8e-03
medulloblastoma, large-cell -3.000 1.3e-05
oligodendroglioma -1.300 4.1e-19
pituitary cancer 2.000 1.7e-06
primitive neuroectodermal tumor -1.500 7.1e-04

Gene RIF (4)

AA Sequence

MENTGWMGKGHRMTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLE      1 - 70
NPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQAESEVGRPEEEEAEAAAGLE     71 - 140
LCSGSGPFTFLHFDKNFVQLCLSAEPSEAPRLLAPAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGR    141 - 210
AAGRACGFAQPGCSCPGEAGAGSTTTTSPGPPAAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYG    211 - 280
EEPEEEPKVKTQWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLR    281 - 350
ETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPQHGGKACEGPELQTKLCSMAACPVEG    351 - 420
QWLEWGPWGPCSTSCANGTQQRSRKCSVAGPAWATCTGALTDTRECSNLECPATDSKWGPWNAWSLCSKT    421 - 490
CDTGWQRRFRMCQATGTQGYPCEGTGEEVKPCSEKRCPAFHEMCRDEYVMLMTWKKAAAGEIIYNKCPPN    491 - 560
ASGSASRRCLLSAQGVAYWGLPSFARCISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRT    561 - 630
YYSGDLLFSVDILRNVTDTFKRATYVPSADDVQRFFQVVSFMVDAENKEKWDDAQQVSPGSVHLLRVVED    631 - 700
FIHLVGDALKAFQSSLIVTDNLVISIQREPVSAVSSDITFPMRGRRGMKDWVRHSEDRLFLPKEVLSLSS    701 - 770
PGKPATSGAAGSPGRGRGPGTVPPGPGHSHQRLLPADPDESSYFVIGAVLYRTLGLILPPPRPPLAVTSR    771 - 840
VMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWDYSRADASSGDWDTENCQTLETQAAHTRCQCQH    841 - 910
LSTFAVLAQPPKDLTLELAGSPSVPLVIGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASN    911 - 980
ILILVGQSRVLSKGVCTMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVV    981 - 1050
AVSVGFTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGISDKSKKQRAGSE   1051 - 1120
RCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVLAMTDRRSVLFQALFAVF   1121 - 1190
NSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSCKNGQLQILSDFEKDVDLACQTVLFKEVN   1191 - 1260
TCNPSTITGTLSRLSLDEDEEPKSCLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEG   1261 - 1330
GLRQLDLTWLRPTEPGSEGDYMVLPRRTLSLQPGGGGGGGEDAPRARPEGTPRRAAKTVAHTEGYPSFLS   1331 - 1400
VDHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKMGSLERKKLRYSDLD   1401 - 1470
FEKVMHTRKRHSELYHELNQKFHTFDRYRSQSTAKREKRWSVSSGGAAERSVCTDKPSPGERPSLSQHRR   1471 - 1540
HQSWSTFKSMTLGSLPPKPRERLTLHRAAAWEPTEPPDGDFQTEV                            1541 - 1585
//

Text Mined References (19)

PMID Year Title