Property Summary

NCBI Gene PubMed Count 70
PubMed Score 558.90
PubTator Score 340.69

Knowledge Summary


No data available


  Disease Sources (5)


  Differential Expression (14)


Accession O60240 Q8N5Y6
Symbols PERI


PANTHER Protein Class (1)

  Ortholog (9)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651672 confirmatory 195 / 0 / 39 Counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical high throughput dose response assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)
652125 confirmatory 20 / 0 / 28 Late stage counterscreen for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5): Luminescence-based biochemical dose response assay to identify inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-1 (PLIN1)(ROUND 2)

Gene RIF (79)

27468581 Based on the PCR with mismatched primers PLIN1 polymorphisms could be identified effectively in Chinese Han population.
26742848 Conserved amphipathic helices mediate lipid droplet targeting of PLIN1, PLIN2, and PLIN3.
25971423 Skeletal muscle PLIN proteins likely play a role in the hydrolysis of triglycerides stored in lipid droplets and the passage of fatty acids to the mitochondria for oxidation.
25529448 The functional PLIN1 rs6496589 may influence the risk of central obesity through possible regulation of lipid storage.
25114292 This plin1 variant binds and stabilizes ABHD5 expression but still fails to inhibit basal lipolysis as effectively as wild-type perilipin 1.
24610610 Use of molecular docking software to design perilipin-1 inhibitors as antiobesity agents.
24269473 In long-term steatosis models in vitro, TIP47, MLDP, adipophilin, and finally perilipin were gradually induced
24126816 After bariatric surgery-induced weight loss, PLIN1 gene/protein expression in SAT increased significantly. Findings suggest a positive functional interaction between PLIN1 & mitochondrial biogenesis-related genes in human adipose tissue.
23642680 Although specific for invasive sebaceous carcinoma, perilipin expression was not helpful in distinguishing sebaceous carcinoma in situ from squamous cell carcinoma in situ with clear cell change.
23517113 Chinese adults with high waist circumference may have a high risk of diabetes, especially those with allele T in rs1052700 or with allele A in rs894160 of perilipin gene and those with perilipin genotype AA (rs894160) may have a high risk of obesity.

AA Sequence

KPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS                                          491 - 522

Text Mined References (73)

PMID Year Title
27468581 2016 An Improved PCR-RFLP Assay for the Detection of a Polymorphism of PLIN1 Gene.
26742848 2016 Conserved Amphipathic Helices Mediate Lipid Droplet Targeting of Perilipins 1-3.
25971423 2015 Piecing together the puzzle of perilipin proteins and skeletal muscle lipolysis.
25529448 2015 A functional variant in the exon 5 of PLIN1 reduces risk of central obesity by possible regulation of lipid storage.
25114292 2015 Clinical and molecular characterization of a novel PLIN1 frameshift mutation identified in patients with familial partial lipodystrophy.
24610610 2014 In silico discovery of a perilipin 1 inhibitor to be used as a new treatment for obesity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269473 2014 Perilipin discerns chronic from acute hepatocellular steatosis.
24126816 2014 CIDEC/FSP27 and PLIN1 gene expression run in parallel to mitochondrial genes in human adipose tissue, both increasing after weight loss.
23642680 2013 Perilipin and adipophilin expression in sebaceous carcinoma and mimics.