Property Summary

NCBI Gene PubMed Count 75
PubMed Score 597.42
PubTator Score 340.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Obesity 678 5.36 2.7
Lipodystrophy, Familial Partial 8 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Familial partial lipodystrophy 12 0.0 5.0

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.379 7.0e-07
adrenocortical adenoma -1.081 1.4e-02
adrenocortical carcinoma -1.296 6.5e-06
Atopic dermatitis -2.400 5.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.747 8.2e-03
breast carcinoma -2.600 4.8e-19
ductal carcinoma in situ -4.300 2.5e-04
fibroadenoma -3.200 3.5e-02
inflammatory breast cancer -1.100 3.3e-02
invasive ductal carcinoma -6.300 1.1e-04
non primary Sjogren syndrome sicca 1.400 1.3e-02
ovarian cancer -1.200 4.0e-03
posterior fossa group B ependymoma 1.100 1.2e-03
psoriasis -1.400 2.8e-03

Synonym

Accession O60240 Q8N5Y6
Symbols PERI
PLIN
FPLD4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (84)

AA Sequence

MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAA      1 - 70
WSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSD     71 - 140
KVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPPDKEESAPAPGHQQAQK    141 - 210
SPKAKPSLLSRVGALTNTLSRYTVQTMARALEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVR    211 - 280
VPWLHSLAAAQEEDHEDQTDTEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAV    281 - 350
TWAPAAVLGMAGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID    351 - 420
NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAPRPGFPAVPRE    421 - 490
KPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS                                          491 - 522
//

Text Mined References (79)

PMID Year Title