Property Summary

NCBI Gene PubMed Count 20
PubMed Score 566.68
PubTator Score 87.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (34)

Disease log2 FC p
active Crohn's disease 1.244 2.9e-02
acute quadriplegic myopathy 1.542 1.4e-04
adult high grade glioma -1.600 2.6e-04
astrocytic glioma -1.400 1.5e-02
Astrocytoma, Pilocytic -1.300 1.6e-03
Atopic dermatitis -1.100 9.5e-05
atypical teratoid / rhabdoid tumor -1.500 2.9e-04
autosomal dominant Emery-Dreifuss muscul... 1.403 5.4e-03
Becker muscular dystrophy 1.060 9.7e-03
breast carcinoma -1.100 5.8e-04
dermatomyositis 1.300 3.2e-03
Duchenne muscular dystrophy 1.295 8.3e-06
ependymoma -1.800 5.2e-03
gastric carcinoma 1.100 3.4e-02
glioblastoma -1.400 4.0e-06
group 4 medulloblastoma 1.100 3.3e-03
intraductal papillary-mucinous adenoma (... -1.500 4.6e-04
intraductal papillary-mucinous carcinoma... -1.100 3.6e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-02
juvenile dermatomyositis 1.145 1.5e-07
lung adenocarcinoma -1.200 1.4e-16
lung cancer -1.300 1.9e-04
lung carcinoma -1.700 1.6e-22
medulloblastoma, large-cell -1.400 1.2e-03
mucosa-associated lymphoid tissue lympho... 1.197 1.6e-02
non-small cell lung cancer -1.540 2.8e-21
oligodendroglioma -1.600 7.1e-03
ovarian cancer -2.300 7.0e-09
pancreatic cancer 1.400 6.6e-03
pancreatic ductal adenocarcinoma liver m... -1.010 3.2e-02
pituitary cancer -1.300 7.7e-07
psoriasis -1.200 1.4e-09
Rheumatoid arthritis 1.100 2.7e-02
ulcerative colitis 1.800 7.1e-06

Gene RIF (5)

AA Sequence

MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDAR      1 - 70
QKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAE     71 - 140
QRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKP    141 - 210
YFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSST    211 - 280
SVEDLPGSKPEPDAISVASEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLP    281 - 350
SPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST    351 - 420
SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG                                       421 - 455
//

Text Mined References (27)

PMID Year Title