Property Summary

NCBI Gene PubMed Count 18
Grant Count 127
R01 Count 55
Funding $31,740,806.73
PubMed Score 511.99
PubTator Score 87.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60239 B3KQW6 Q5JWV9 SH3BP-5
Symbols SAB
SH3BP-5

Gene

PANTHER Protein Class (2)

PDB

4H3B  

Gene RIF (3)

PMID Text
25666017 The interplay of p-JNK with mitochondrial Sab leads to impaired respiration, ROS production, sustained JNK activation, and apoptosis.
23861391 SH3BP5 binds to JNK and directly inhibits JNK through its two putative mitogen-activated protein kinase interaction motifs (KIMs).
15158451 mitochondrial protein Sab is phosphorylated by stress-activated protein kinase 3

AA Sequence

MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDAR      1 - 70
QKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAE     71 - 140
QRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKP    141 - 210
YFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSST    211 - 280
SVEDLPGSKPEPDAISVASEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLP    281 - 350
SPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST    351 - 420
SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG                                       421 - 455
//

Text Mined References (25)

PMID Year Title
26506309 2015 REI-1 Is a Guanine Nucleotide Exchange Factor Regulating RAB-11 Localization and Function in C. elegans Embryos.
25666017 2015 Sab (Sh3bp5) dependence of JNK mediated inhibition of mitochondrial respiration in palmitic acid induced hepatocyte lipotoxicity.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
23861391 2013 SH3-binding protein 5 mediates the neuroprotective effect of the secreted bioactive peptide humanin by inhibiting c-Jun NH2-terminal kinase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22488850 2012 Genome-wide search for replicable risk gene regions in alcohol and nicotine co-dependence.
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...