Property Summary

NCBI Gene PubMed Count 40
PubMed Score 153.65
PubTator Score 97.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.032 3.9e-02
acute quadriplegic myopathy 1.776 3.3e-06
Amyotrophic lateral sclerosis 1.086 6.3e-05
Atopic dermatitis -1.100 1.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.438 5.8e-03
Breast cancer 2.200 2.8e-02
dermatomyositis 1.100 1.0e-03
Duchenne muscular dystrophy 1.444 4.3e-06
invasive ductal carcinoma -1.300 2.5e-03
lung cancer -2.300 6.2e-03
malignant mesothelioma -1.100 9.9e-06
ovarian cancer -2.300 2.3e-05
pancreatic cancer 1.100 3.9e-03
primary pancreatic ductal adenocarcinoma 1.217 3.8e-03

Gene RIF (18)

AA Sequence

MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGD      1 - 70
MEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADW     71 - 140
VSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKR    141 - 210
LSTPSASTY                                                                 211 - 219
//

Text Mined References (46)

PMID Year Title