Property Summary

NCBI Gene PubMed Count 34
Grant Count 22
R01 Count 6
Funding $1,513,923.23
PubMed Score 130.11
PubTator Score 97.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (15)

PMID Text
25753537 regulates mitophagy during hypoxia, whereas NIX is required for mitophagy during development of the erythroid lineage.
22984526 Nix protein positively regulates NF-kappaB activation in gliomas
22292033 The physical interaction of Mieap, BNIP3 and NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix.
21264228 mitochondrial ROS and NIX are essential factors for Mieap-induced accumulation of lysosome-like organelles within mitochondria
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20010802 Nix functions as an autophagy receptor, which mediates mitochondrial clearance after mitochondrial damage and during erythrocyte differentiation
19273585 Results suggest that hypoxia-induced autophagy via BNIP3 and BNIP3L is clearly a survival mechanism that promotes tumor progression.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18670647 Homozygous deletions in a number of biologically important genes were found in prostate cancer cell lines, including PPP2R2A and BNIP3L identified in this study.
18551130 Results report that oxygen deprivation can activate the autophagic pathway in human cancer cell lines via AMPK activity, independent of HIF-1, BNIP3, and BNIP3L.
More...

AA Sequence

MSSHLVEPPPPLHNNNNNCEENEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGD      1 - 70
MEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADW     71 - 140
VSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKR    141 - 210
LSTPSASTY                                                                 211 - 219
//

Text Mined References (40)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25753537 2015 Mitochondrial autophagy: Origins, significance, and role of BNIP3 and NIX.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22984526 2012 Nix protein positively regulates NF-?B activation in gliomas.
22645275 2012 Identification of novel ATP13A2 interactors and their role in ?-synuclein misfolding and toxicity.
22292033 2012 BNIP3 and NIX mediate Mieap-induced accumulation of lysosomal proteins within mitochondria.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21264228 2011 Mieap, a p53-inducible protein, controls mitochondrial quality by repairing or eliminating unhealthy mitochondria.
More...