Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.81
PubTator Score 11.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis 1.044 6.4e-03
adult high grade glioma -1.400 1.2e-07
Astrocytoma, Pilocytic -1.100 1.1e-03
atypical teratoid / rhabdoid tumor -1.400 6.2e-04
autosomal dominant Emery-Dreifuss muscul... -1.011 3.5e-02
Breast cancer -2.200 1.7e-22
breast carcinoma -1.300 8.7e-07
colon cancer -3.700 8.1e-07
glioblastoma -1.100 6.7e-07
interstitial lung disease 1.500 2.0e-03
intraductal papillary-mucinous adenoma (... 1.900 4.5e-04
intraductal papillary-mucinous carcinoma... 1.900 3.2e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.9e-03
invasive ductal carcinoma -1.300 9.1e-04
limb girdle muscular dystrophy 2I -1.024 1.0e-02
lung cancer -1.200 3.3e-02
medulloblastoma -1.200 1.0e-05
medulloblastoma, large-cell -1.600 5.2e-07
osteosarcoma 1.325 2.3e-02
ovarian cancer -1.900 8.8e-13
Pick disease 1.700 1.6e-03
primitive neuroectodermal tumor -1.100 1.1e-04
psoriasis -1.400 3.8e-08
subependymal giant cell astrocytoma -1.230 5.5e-03

Gene RIF (6)

AA Sequence

MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGD      1 - 70
TDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIA     71 - 140
EYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIED    141 - 210
VRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRN    211 - 280
KLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEM    281 - 350
EEENKESSSSSSEEEEGEDEASESETEKEADKKPEAFVNHSNSESKSSITEQIPAPAQNTFSASSARRFS    351 - 420
SGLFNKPEEPKDESPSSWRLGLRKTGSHNMLSEVANSREPIRDRGSSIYRSSSSPRISALLDNKDKEREN    421 - 490
KSYISSLAPRKLNSTSDIEEKENRESAVNLVRSGSYTRQLWRDEAKGNEIPQTIAPSTYVSTYLKRTPHK    491 - 560
SQADTTAEKTADNVSSSTPLCVITNRPLPSTANGVTATPVLSITGTDSSVEAREKRRSYLTPVRDEEAES    561 - 630
LRKARSRQARQTRRSTQGVTLTDLQEAERTFSRSRAERQAQEQPREKPTDTEGLEGSPEKHEPSAVPATE    631 - 700
AGEGQQPWGRSLDEEPICHRLRCPAQPDKPTTPASPSTSRPSLYTSSHLLWTNRFSVPDSESSETTTNTT    701 - 770
TAKEMDKNENEEADLDEQSSKRLSIRERRRPKERRRGTGINFWTKDEDETDGSEEVKETWHERLSRLESG    771 - 840
GSNPTTSDSYGDRASARARREAREARLATLTSRVEEDSNRDYKKLYESALTENQKLKTKLQEAQLELADI    841 - 910
KSKLEKVAQQKQEKTSDRSSVLEMEKRERRALERKMSEMEEEMKVLTELKSDNQRLKDENGALIRVISKL    911 - 980
SK                                                                        981 - 982
//

Text Mined References (27)

PMID Year Title