Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.77
PubTator Score 10.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cutaneous lupus erythematosus 1.100 1.2e-02
gastric carcinoma 1.500 2.7e-02
glioblastoma 1.800 5.7e-03
intraductal papillary-mucinous neoplasm ... -1.600 3.0e-03
lung adenocarcinoma -1.100 9.2e-11
lung cancer -2.300 4.5e-05
lung carcinoma -2.500 9.2e-28
nephrosclerosis 1.236 1.2e-05
non-small cell lung cancer -2.056 4.2e-23
osteosarcoma -3.168 3.9e-05
ovarian cancer -1.500 7.9e-06
primary Sjogren syndrome 1.900 9.3e-04
psoriasis -1.400 3.5e-04
subependymal giant cell astrocytoma 1.560 2.6e-02
tuberculosis 1.200 4.9e-09
ulcerative colitis 2.100 1.9e-05
Waldenstrons macroglobulinemia 1.226 2.0e-03

Synonym

Accession O60234 Q6IB37 GMF-gamma
Symbols GMF-GAMMA

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVV      1 - 70
YSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSF     71 - 140
FR                                                                        141 - 142
//

Text Mined References (21)

PMID Year Title