Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
Funding $682,026.89
PubMed Score 12.77
PubTator Score 10.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.236 0.000
Waldenstrons macroglobulinemia 1.226 0.002
cutaneous lupus erythematosus 1.100 0.012
psoriasis -1.400 0.000
osteosarcoma -3.168 0.000
glioblastoma 1.800 0.006
tuberculosis 1.200 0.000
non-small cell lung cancer -2.056 0.000
intraductal papillary-mucinous neoplasm ... -1.600 0.003
lung cancer -3.300 0.000
lung adenocarcinoma -2.261 0.000
primary Sjogren syndrome 1.900 0.001
subependymal giant cell astrocytoma 1.560 0.026
lung carcinoma -2.500 0.000
gastric carcinoma 1.500 0.027
ulcerative colitis 2.100 0.000
ovarian cancer -1.500 0.000

Gene RIF (7)

PMID Text
26895964 These results indicate that the effects of GMFG on monocyte migration and adhesion probably occur through preventing ubiquitin-mediated proteasome degradation of alpha5beta1-integrin and facilitating effective beta1-integrin recycling back to the plasma membrane.
24818551 In this study, knockdown of GMF-gamma by RNA interference enhanced actin polymerization and contraction in human airway smooth muscle (HASM) cells and tissues without affecting myosin phosphorylation.
23897816 Together, the results suggest that GMFG functions by a mechanism similar to that of other ADF/cofilin family members, displaying a preference for ADP-Arp2/3 complex and undergoing inhibition by phosphorylation of a serine residue near the N terminus.
23677465 our findings suggest that GMFG functions as a negative regulator of TLR4 signaling by facilitating TLR4 endocytic trafficking in macrophages
22510515 regulates the migration and adherence of human T lymphocytes
17127212 GMFG is a hematopoietic-specific protein that may mediate the pluripotentiality and lineage commitment of human hematopoietic stem cells
12591611 characterized the promoter region and found the putative cis-acting regulatory elements responsible for promoter activity

AA Sequence

MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVV      1 - 70
YSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSF     71 - 140
FR                                                                        141 - 142
//

Text Mined References (20)

PMID Year Title
26895964 2016 Glia Maturation Factor-? Regulates Monocyte Migration through Modulation of ?1-Integrin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24818551 2014 Glia maturation factor-? phosphorylation at Tyr-104 regulates actin dynamics and contraction in human airway smooth muscle.
23897816 2013 Glia maturation factor (GMF) interacts with Arp2/3 complex in a nucleotide state-dependent manner.
23677465 2013 Glia maturation factor-? negatively modulates TLR4 signaling by facilitating TLR4 endocytic trafficking in macrophages.
22510515 2012 Glia maturation factor gamma regulates the migration and adherence of human T lymphocytes.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17127212 2006 Glia maturation factor gamma (GMFG): a cytokine-responsive protein during hematopoietic lineage development and its functional genomics analysis.
More...