Property Summary

NCBI Gene PubMed Count 52
Grant Count 135
R01 Count 80
Funding $18,555,023.53
PubMed Score 229.84
PubTator Score 38.82

Knowledge Summary

Patent (10,919)

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
astrocytic glioma -3.500 0.001
ependymoma -4.200 0.000
oligodendroglioma -3.000 0.008
glioblastoma -4.000 0.000
osteosarcoma -1.094 0.014
medulloblastoma -4.100 0.000
cystic fibrosis -3.474 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
medulloblastoma, large-cell -4.200 0.001
primitive neuroectodermal tumor -4.300 0.000
acute quadriplegic myopathy -1.071 0.000
primary pancreatic ductal adenocarcinoma 1.399 0.012
intraductal papillary-mucinous neoplasm ... 1.400 0.008
pediatric high grade glioma -2.900 0.000
pilocytic astrocytoma -3.800 0.000
spina bifida -1.193 0.043
Pick disease -1.900 0.017
Breast cancer -1.300 0.000
pituitary cancer 1.500 0.000
Down syndrome -1.100 0.005
pancreatic cancer 1.400 0.026

Synonym

Accession O60229 A8MSI4 C9JQ37 Q6ZN45 Q8TBQ5 Q9NSZ4 Q9Y2A5
Symbols DUO
CHD5
DUET
TRAD
CHDS5
HAPIP
ARHGEF24

Gene

Gene RIF (27)

PMID Text
25917671 4 KALRN gene SNPs were studied in Han ischemic stroke patients. rs11712619 seemed associated with lacunar stroke until risk factors were considered. re6438833 was significantly associated with ischemic and lacunar stroke.
25316661 consider the GG genotype and the G allele of rs9289231 polymorphism of KALRN to be genetic risk factors for CAD in an Iranian population, especially in early-stage atherosclerotic vascular disease
25224588 A sequence variant in human KALRN impairs protein ability to activate Rac1 and coincides with reduced cortical thickness.
22720673 The age-at-onset of Huntington disease (HD) is not associated with eleven SNPs, including SNP rs10934657 in the kalirin gene in 680 European HD patients.
22458949 In both anterior cingulate cortex (ACC) and dorsolateral prefrontal cortex (DLPFC), study found a reduction of Duo expression and PAK1 phosphorylation in schizophrenia. Cdc42 protein expression was decreased in ACC but not in DLPFC
22429885 The kalirin expression were reduced in Alzheimer disease with psychosis.
22404213 Knockdown of kalirin, RhoGEF kinase (KALRN) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22194219 Neuronal guanine nucleotide exchange factor (GEF) kalirin is emerging as a key regulator of structural and functional plasticity at dendritic spines.
22120753 We found Kalirin-9 expression to be paradoxically increased in schizophrenia
21664346 KALRN gene variation is not associated with overall ischemic stroke
More...

AA Sequence

MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIR      1 - 70
QEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKT     71 - 140
NFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEM    141 - 210
LARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPK    211 - 280
ITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDL    281 - 350
QTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF    351 - 420
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGN    421 - 490
SESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFL    491 - 560
SKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFV    561 - 630
RRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKE    631 - 700
GEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQ    701 - 770
LRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT    771 - 840
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGE    841 - 910
SMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEVLLQAGHYDADAIREC    911 - 980
AEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIP    981 - 1050
LISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWT   1051 - 1120
LKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKL   1121 - 1190
LIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR   1191 - 1260
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIF   1261 - 1330
GNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQR   1331 - 1400
HGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLD   1401 - 1470
VQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGD   1471 - 1540
PCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRD   1541 - 1610
GVEDIDSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPS   1611 - 1680
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESVANLQAQPS   1681 - 1750
LNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSADE   1751 - 1820
KSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQASTEVPTAADLVNAIEKLVKNKLSLEG   1821 - 1890
SSYRGSLKDPAGCLNEGMAPPTPPKNPEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEE   1891 - 1960
KGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYI   1961 - 2030
VAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRC   2031 - 2100
NDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMF   2101 - 2170
KRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQDINQVLETQRDFLNALQSPIEY   2171 - 2240
QRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGSSYNPPLPPLKISTSNGSPGFEYHQPGDKFEA   2241 - 2310
SKQNDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSIL   2311 - 2380
APLTKATAAESSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDD   2381 - 2450
LDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSATY   2451 - 2520
TVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLP   2521 - 2590
PSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSEFVR   2591 - 2660
LPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAAL   2661 - 2730
LQHLQHPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAH   2731 - 2800
LDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTY   2801 - 2870
VMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPH   2871 - 2940
NGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT                            2941 - 2985
//

Text Mined References (59)

PMID Year Title
25917671 2015 KALRN Rare and Common Variants and Susceptibility to Ischemic Stroke in Chinese Han Population.
25316661 2014 The Kalirin Gene rs9289231 Polymorphism as a Novel Predisposing Marker for Coronary Artery Disease.
25224588 2014 A sequence variant in human KALRN impairs protein function and coincides with reduced cortical thickness.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24586183 2014 Identification of novel genetic Loci associated with thyroid peroxidase antibodies and clinical thyroid disease.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23284848 2012 The Guanine nucleotide exchange factor kalirin-7 is a novel synphilin-1 interacting protein and modifies synphilin-1 aggregate transport and formation.
22738176 2012 Structural organization of the nine spectrin repeats of Kalirin.
22720673 2012 Genetic analysis of polymorphisms in the kalirin gene for association with age-at-onset in European Huntington disease patients.
22458949 2012 Abnormalities of the Duo/Ras-related C3 botulinum toxin substrate 1/p21-activated kinase 1 pathway drive myosin light chain phosphorylation in frontal cortex in schizophrenia.
More...