Property Summary

NCBI Gene PubMed Count 55
PubMed Score 240.07
PubTator Score 38.82

Knowledge Summary

Patent (10,919)

TINX Plot

  Disease (6)

Expression

  Differential Expression (22)

Disease log2 FC p
acute quadriplegic myopathy -1.071 1.0e-05
adult high grade glioma -2.800 9.0e-03
astrocytic glioma -3.500 9.6e-04
Astrocytoma, Pilocytic -3.800 1.5e-06
atypical teratoid / rhabdoid tumor -4.700 7.4e-10
Breast cancer -1.300 2.9e-07
cystic fibrosis -3.474 3.2e-05
Down syndrome -1.100 4.6e-03
ependymoma -4.200 4.8e-04
glioblastoma -3.200 1.1e-07
group 3 medulloblastoma -3.000 3.3e-02
intraductal papillary-mucinous neoplasm ... 1.400 8.2e-03
malignant mesothelioma 1.600 9.0e-05
medulloblastoma, large-cell -4.200 8.6e-04
oligodendroglioma -3.000 8.3e-03
osteosarcoma -1.094 1.4e-02
pancreatic cancer 1.400 2.6e-02
Pick disease -1.900 1.7e-02
pituitary cancer 1.500 2.5e-04
primary pancreatic ductal adenocarcinoma 1.399 1.2e-02
primitive neuroectodermal tumor -4.300 4.8e-05
spina bifida -1.193 4.3e-02

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIR      1 - 70
QEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQKT     71 - 140
NFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEM    141 - 210
LARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPK    211 - 280
ITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDL    281 - 350
QTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF    351 - 420
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGN    421 - 490
SESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFL    491 - 560
SKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFV    561 - 630
RRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKE    631 - 700
GEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQ    701 - 770
LRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT    771 - 840
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGE    841 - 910
SMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEVLLQAGHYDADAIREC    911 - 980
AEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIP    981 - 1050
LISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWT   1051 - 1120
LKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKL   1121 - 1190
LIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR   1191 - 1260
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIF   1261 - 1330
GNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQR   1331 - 1400
HGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLD   1401 - 1470
VQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGD   1471 - 1540
PCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRD   1541 - 1610
GVEDIDSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPS   1611 - 1680
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESVANLQAQPS   1681 - 1750
LNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSADE   1751 - 1820
KSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQASTEVPTAADLVNAIEKLVKNKLSLEG   1821 - 1890
SSYRGSLKDPAGCLNEGMAPPTPPKNPEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEE   1891 - 1960
KGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYI   1961 - 2030
VAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRC   2031 - 2100
NDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMF   2101 - 2170
KRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQDINQVLETQRDFLNALQSPIEY   2171 - 2240
QRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGSSYNPPLPPLKISTSNGSPGFEYHQPGDKFEA   2241 - 2310
SKQNDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSIL   2311 - 2380
APLTKATAAESSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDD   2381 - 2450
LDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSATY   2451 - 2520
TVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLP   2521 - 2590
PSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSEFVR   2591 - 2660
LPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAAL   2661 - 2730
LQHLQHPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAH   2731 - 2800
LDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTY   2801 - 2870
VMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPH   2871 - 2940
NGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT                            2941 - 2985
//

Text Mined References (62)

PMID Year Title