Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.53
PubTator Score 6.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Synovial sarcoma 25 4.296 2.1

Gene RIF (1)

AA Sequence

MNGDDAFVRRPRVGSQIPEKMQKAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPF      1 - 70
MRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLR     71 - 140
PSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE                          141 - 188
//

Text Mined References (15)

PMID Year Title