Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.53
PubTator Score 18.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Synovial sarcoma 25 5.747 2.9
Parapsoriasis 6 3.103 1.6

Gene RIF (5)

AA Sequence

MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPF      1 - 70
MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLC     71 - 140
PPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE                          141 - 188
//

Text Mined References (18)

PMID Year Title