Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
Funding $175,964.34
PubMed Score 10.11
PubTator Score 18.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (5)

PMID Text
24710929 The mRNA levels of SSX1 and SSX4 are associated with multiple myeloma clinical stage
24645645 SSX2, SSX3, and SSX4 are expressed only in 3.5% early-stage non-small cell lung cancer patients.
23625514 Our results suggest that GAGE, XAGE1 and SSX4 might each have a role in melanoma progression
21347689 we found that the SSX4 and MAGE-A3 genes are frequently expressed in brain tumor cell lines
15814740 existence of CD4+ T cells specific for multiple SSX-4 derived sequences in circulating lymphocytes from melanoma patients

AA Sequence

MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPF      1 - 70
MRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLC     71 - 140
PPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE                          141 - 188
//

Text Mined References (18)

PMID Year Title
24710929 2014 Expression of cancer-testis antigen in multiple myeloma.
24645645 2014 SSX2-4 expression in early-stage non-small cell lung cancer.
23625514 2013 Effects of CT-Xp gene knock down in melanoma cell lines.
21347689 2011 Identification and functional characterization of glioma-specific promoters and their application in suicide gene therapy.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15814740 2005 CD4+ T cell responses to SSX-4 in melanoma patients.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
More...