Property Summary

NCBI Gene PubMed Count 41
PubMed Score 156.80
PubTator Score 95.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 3.6e-02

 GO Function (1)

Gene RIF (12)

AA Sequence

MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERF      1 - 70
IDTSQFILNRLEQTQKSKPVFSESLSD                                                71 - 97
//

Text Mined References (45)

PMID Year Title