Property Summary

NCBI Gene PubMed Count 74
PubMed Score 773.06
PubTator Score 140.33

Knowledge Summary


No data available



Accession O60218 A4D1P1 O75890 Q6FHF3 Q8IWZ1
Symbols HIS


PANTHER Protein Class (2)


4GQ0   1ZUA   4GA8   4GAB   4GQG   4I5X   4ICC   4JIH   4JII   4WEV   4XZL   4XZM   4XZN   5LIK   5LIU   5LIW   5LIX  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG

Gene RIF (63)

27239845 Even at early stages of malignant transformationa considerable increase in AKR1B10 mRNA content was observed in 80% of tumors
26835713 AKR1B10 is overexpressed in nasopharyngeal hyperplasia, benign tumors, and carcinomas, being a potential new biomarker.
25887478 Our data suggest that genetic variants in the AKR1B10 locus may influence human eating behavior.
25686905 AKR1B10 is a doxorubicin-resistance gene in the gastric cancer cells, and is responsible for elevating the migrating and invasive potentials of the cells through induction of MMP2.
25532697 The three-dimensional structure of AKR1B10 with sulindac.
25487531 It would appear that hepatitis C virus infection alone increases AKR1B10 expression, which manifests itself as enhanced urinary excretion of polyols with reduced urinary excretion of their corresponding hexoses.
25463304 The co-introduction of the c-Jun protein resulted in a decrease in the mRNA levels and promoter activity of AKR1B10.
25304374 AKR1B10 is a unique enzyme involved in pancreatic carcinogenesis via modulation of the Kras-E-cadherin pathway.
25289770 Autophagy and AKR1B10 contribute to the defense system.
25156503 Upregulation of AKR1B10 is associated with cisplatin resistance in lung cancer.

AA Sequence

LSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY                                      281 - 316

Text Mined References (78)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26835713 2016 Overexpression of AKR1B10 in nasopharyngeal carcinoma as a potential biomarker.
25887478 2015 Genetic variants in AKR1B10 associate with human eating behavior.
25686905 2015 Acquisition of doxorubicin resistance facilitates migrating and invasive potentials of gastric cancer MKN45 cells through up-regulating aldo-keto reductase 1B10.
25532697 2015 Structural analysis of sulindac as an inhibitor of aldose reductase and AKR1B10.
25487531 2015 Metabolomics reveals that aldose reductase activity due to AKR1B10 is upregulated in hepatitis C virus infection.
25463304 2015 Down-regulation of aldo-keto reductase AKR1B10 gene expression by a phorbol ester via the ERK/c-Jun signaling pathway.
25304374 2014 Knockdown or inhibition of aldo-keto reductase 1B10 inhibits pancreatic carcinoma growth via modulating Kras-E-cadherin pathway.
25289770 2015 Protective roles of aldo-keto reductase 1B10 and autophagy against toxicity induced by p-quinone metabolites of tert-butylhydroquinone in lung cancer A549 cells.
25156503 2014 Nitric oxide confers cisplatin resistance in human lung cancer cells through upregulation of aldo-keto reductase 1B10 and proteasome.