Property Summary

Ligand Count 51
NCBI Gene PubMed Count 84
PubMed Score 873.50
PubTator Score 140.33

Knowledge Summary


No data available



Accession O60218 A4D1P1 O75890 Q6FHF3 Q8IWZ1
Symbols HIS


PANTHER Protein Class (2)

  Ortholog (2)

Species Source Disease

Protein-protein Interaction (3)

PDB (19)

Gene RIF (73)

AA Sequence

LSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY                                      281 - 316

Text Mined References (88)

PMID Year Title