Property Summary

Ligand Count 51
NCBI Gene PubMed Count 84
PubMed Score 873.50
PubTator Score 140.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60218 A4D1P1 O75890 Q6FHF3 Q8IWZ1
Symbols HIS
HSI
ARL1
ARL-1
ALDRLn
AKR1B11
AKR1B12

Gene

PANTHER Protein Class (2)

PDB

4GQ0   1ZUA   4GA8   4GAB   4GQG   4I5X   4ICC   4JIH   4JII   4WEV   4XZL   4XZM   4XZN   5LIK   5LIU   5LIW   5LIX   5LIY   5M2F  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (73)

AA Sequence

MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR      1 - 70
EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD     71 - 140
AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY    141 - 210
SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK    211 - 280
LSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY                                      281 - 316
//

Text Mined References (88)

PMID Year Title