Property Summary

NCBI Gene PubMed Count 74
Grant Count 94
R01 Count 66
Funding $10,182,452.63
PubMed Score 165.19
PubTator Score 184.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.011
Multiple myeloma 1.404 0.004
malignant mesothelioma 1.400 0.000
astrocytic glioma 1.200 0.043
ependymoma 1.100 0.008
oligodendroglioma 1.300 0.001
osteosarcoma 2.742 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.200 0.008
medulloblastoma 1.200 0.020
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.300 0.000
lung cancer 1.700 0.009
Breast cancer 2.500 0.027
lung adenocarcinoma 1.460 0.001
invasive ductal carcinoma 1.700 0.028

Synonym

Accession O60216 A8K0E0 Q15001 Q99568 hHR21
Symbols HR21
MCD1
NXP1
SCC1
CDLS4
hHR21
HRAD21

Gene

PDB

4PJU   4PJW   4PK7  

Gene RIF (38)

PMID Text
26420833 Reduced RAD21 destabilizes high-level gene amplification by disrupting pre-replication complex bindings in human cancers with chromosomal instability.
25881024 found well-positioned CTCF and RAD21 peaks approximately 60-80 bp upstream of the TSS in the unidirectional genes. The peak heights were related to the amount of antisense transcription. Results provide insights into the distribution of histone modifications at promoters and suggest a novel role of CTCF and cohesin as regulators of transcriptional direction.
25575569 Some patients with chronic intestinal pseudo-obstruction carry mutations in RAD21 that disrupt the ability of its product to regulate genes such as RUNX1 and APOB.
25464844 Elevated RAD21 expression tracks with reactivation of L1 expression in human sporadic colorectal cancer.
25414306 cohesin's proposed DNA exit gate is formed by interactions between Scc1 and the coiled-coil region of Smc3.
25299688 Studied the role of looping in large-scale (supra Mb) folding of human chromosomes by knocking down the gene that codes for CTCF and the one coding for Rad21, an essential subunit of cohesin.
25006131 Cross-sectional deep-sequencing analysis for clonal hierarchy demonstrated STAG2, SMC3, and RAD21 mutations to be ancestral in 18%, 18%, and 47% of cases, respectively, and each expanded to clonal dominance concordant with disease transformation
24548858 RAD21 expression in CRC is associated with aggressive disease especially in KRAS mutant tumours and resistance to chemoradiotherapy.
24415941 CTCF and Rad21 act as host cell restriction factors for Kaposi's sarcoma-associated herpesvirus (KSHV) lytic replication by modulating viral gene transcription.
24378232 This study reports the first intragenic deletion and frameshift mutations identified in RAD21 in two patients presenting with atypical Cornelia de Lange syndrome.
More...

AA Sequence

MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRK      1 - 70
AKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRV     71 - 140
EEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLE    141 - 210
YEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDS    211 - 280
VDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTT    281 - 350
LDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF    351 - 420
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMP    421 - 490
PQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEEDEDASGGDQDQEERRWNKRT    491 - 560
QQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHI    561 - 630
I//

Text Mined References (79)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26420833 2016 Reduced cohesin destabilizes high-level gene amplification by disrupting pre-replication complex bindings in human cancers with chromosomal instability.
25881024 2015 Different distribution of histone modifications in genes with unidirectional and bidirectional transcription and a role of CTCF and cohesin in directing transcription.
25575569 2015 Mutations in RAD21 disrupt regulation of APOB in patients with chronic intestinal pseudo-obstruction.
25464844 2014 Cohesin Rad21 mediates loss of heterozygosity and is upregulated via Wnt promoting transcriptional dysregulation in gastrointestinal tumors.
25416956 2014 A proteome-scale map of the human interactome network.
25414306 2014 Characterization of a DNA exit gate in the human cohesin ring.
25299688 2014 Depletion of the chromatin looping proteins CTCF and cohesin causes chromatin compaction: insight into chromatin folding by polymer modelling.
25006131 2014 Genetic alterations of the cohesin complex genes in myeloid malignancies.
24548858 2014 RAD21 cohesin overexpression is a prognostic and predictive marker exacerbating poor prognosis in KRAS mutant colorectal carcinomas.
More...