Property Summary

NCBI Gene PubMed Count 3
Grant Count 28
R01 Count 20
Funding $3,331,600.1
PubMed Score 18.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000

AA Sequence

MSPESKKLFNIIILGVAFMFMFTAFQTCGNVAQTVIRSLNRTDFHGSGYTSMAIIYGVFSASNLITPSVV      1 - 70
AIVGPQLSMFASGLFYSMYIAVFIQPFPWSFYTASVFIGIAAAVLWTAQGNCLTINSDEHSIGRNSGIFW     71 - 140
ALLQSSLFFGNLYIYFAWQGKTQISESDRRTVFIALTVISLVGTVLFFLIRKPDSENVLGEDESSDDQDM    141 - 210
EVNESAQNNLTKAVDAFKKSFKLCVTKEMLLLSITTAYTGLELTFFSGVYGTCIGATNKFGAEEKSLIGL    211 - 280
SGIFIGIGEILGGSLFGLLSKNNRFGRNPVVLLGILVHFIAFYLIFLNMPGDAPIAPVKGTDSSAYIKSS    281 - 350
KEVAILCSFLLGLGDSCFNTQLLSILGFLYSEDSAPAFAIFKFVQSICAAVAFFYSNYLLLHWQLLVMVI    351 - 420
FGFFGTISFFTVEWEAAAFVARGSDYRSI                                             421 - 449
//

Text Mined References (5)

PMID Year Title
23776548 2013 Genetic loci for retinal arteriolar microcirculation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9358160 1997 Characterization of multiple alternative RNAs resulting from antisense transcription of the PR264/SC35 splicing factor gene.