Property Summary

NCBI Gene PubMed Count 9
PubMed Score 28.68
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT      1 - 70
AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN     71 - 140
RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY    141 - 210
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM       211 - 277
//

Text Mined References (9)

PMID Year Title