Property Summary

NCBI Gene PubMed Count 9
Grant Count 8
R01 Count 5
Funding $851,299.17
PubMed Score 27.97
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
19474452 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MEAPGPAQAAAAESNSREVTEDAADWAPALCPSPEARSPEAPAYRLQDCDALVTMGTGTFGRVHLVKEKT      1 - 70
AKHFFALKVMSIPDVIRRKQEQHVHNEKSVLKEVSHPFLIRLFWTWHEERFLYMLMEYVPGGELFSYLRN     71 - 140
RGHFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY    141 - 210
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKLYFPRHLDFHVKTGRMM       211 - 277
//

Text Mined References (9)

PMID Year Title
19474452 2009 Perioperative genomic profiles using structure-specific oligonucleotide probes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9889101 1998 A selective difference between human Y-chromosomal DNA haplotypes.
9302280 1997 Abnormal XY interchange between a novel isolated protein kinase gene, PRKY, and its homologue, PRKX, accounts for one third of all (Y+)XX males and (Y-)XY females.
9154127 1997 FISH localization of the human Y-homolog of protein kinase PRKX (PRKY) to Yp11.2 and two pseudogenes to 15q26 and Xq12-->q13.
9088640 1997 High-resolution fluorescence in situ hybridization of human Y-linked genes on released chromatin.
7633447 1995 The human protein kinase gene PKX1 on Xp22.3 displays Xp/Yp homology and is a site of chromosomal instability.