Property Summary

NCBI Gene PubMed Count 40
Grant Count 7
R01 Count 5
Funding $746,612.97
PubMed Score 32.45
PubTator Score 16.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.500 0.000
osteosarcoma -1.088 0.022
lung cancer 1.700 0.001

 GWAS Trait (1)

Gene RIF (8)

PMID Text
26124052 HsOrc4 could have a fundamental function in the process of initiation of replication by remodeling the structure of origin of replication using the energy of supercoiled DNA.
22333897 compared with homozygous missense mutations, compound heterozygous mutations appeared to have a more severe effect on phenotype, causing more severe growth retardation in ORC4
21358631 identified three different mutations in the gene encoding ORC4, a component of the eukaryotic origin recognition complex, in five individuals with Meier-Gorlin syndrome
20010161 describe 3 patients with B-cell lymphoproliferative disorders (2 with non-Hodgkin lymphoma and 1 with nonsecretory multiple myeloma) carrying a novel A286V mutation within ORC4L gene
19690980 DNA binding activity of HsOrc4 depends on length and structure of DNA with triplex being the protein's preferred binding target.
19074885 Observational study of gene-disease association. (HuGE Navigator)
15910003 Study using HCT116 haplo-insufficient cells and Orc2 hypomorphic cells demonstrates that the binding of human Ku to replication origins precedes that of Orc-3, -4, and -6 subunit binding.
10460412 Biochemical characterization of the mouse homolog

AA Sequence

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG      1 - 70
SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL     71 - 140
EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF    141 - 210
SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH    211 - 280
MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY    281 - 350
NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN    351 - 420
CPTDVRQWATSSLSWL                                                          421 - 436
//

Text Mined References (47)

PMID Year Title
26124052 2015 HsOrc4-Dependent Dna Remodeling of the ori-? Dhfr Replicator.
25416956 2014 A proteome-scale map of the human interactome network.
24989122 2014 A role for DNA polymerase ? in the timing of DNA replication.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22427655 2012 Leucine-rich repeat and WD repeat-containing protein 1 is recruited to pericentric heterochromatin by trimethylated lysine 9 of histone H3 and maintains heterochromatin silencing.
22333897 2012 Meier-Gorlin syndrome genotype-phenotype studies: 35 individuals with pre-replication complex gene mutations and 10 without molecular diagnosis.
21358632 2011 Mutations in the pre-replication complex cause Meier-Gorlin syndrome.
21358631 2011 Mutations in origin recognition complex gene ORC4 cause Meier-Gorlin syndrome.
More...