Property Summary

NCBI Gene PubMed Count 44
PubMed Score 33.68
PubTator Score 16.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.700 7.4e-04
osteosarcoma -1.088 2.2e-02
psoriasis -1.500 1.9e-04

 GWAS Trait (2)

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG      1 - 70
SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL     71 - 140
EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF    141 - 210
SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH    211 - 280
MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY    281 - 350
NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN    351 - 420
CPTDVRQWATSSLSWL                                                          421 - 436
//

Text Mined References (51)

PMID Year Title