Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 5
Funding $180,362.3
PubMed Score 29.88
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.700 0.029
non primary Sjogren syndrome sicca 1.200 0.014
ovarian cancer 1.100 0.001

Synonym

Accession O43924 O43250 GMP-PDE delta
Symbols PDED
JBTS22

Gene

PANTHER Protein Class (2)

PDB

5E8F   1KSG   1KSH   1KSJ   3T5G   3T5I   4JHP   4JV6   4JV8   4JVB   4JVF   5E80   5F2U  

Gene RIF (4)

PMID Text
24166846 Study identifies PDE6D as a novel Joubert syndrome gene and provides the first evidence of prenyl-binding-dependent trafficking in ciliopathies.
23559067 RPGR is acting as a scaffold protein recruiting cargo-loaded PDE6D and Arl3 to release lipidated cargo into cilia.
23150559 findings indicate that ARL13B, INPP5E, PDE6D, and CEP164 form a distinct functional network that is involved in JBTS and NPHP but independent of the ones previously defined by NPHP and MKS proteins
22179043 Data show that PDEdelta activity augments K/Hras signalling by enriching Ras at the plasma membrane.

AA Sequence

MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ      1 - 70
MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV     71 - 140
STSRVRLFYV                                                                141 - 150
//

Text Mined References (31)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
24401286 2014 Prenylation defects in inherited retinal diseases.
24166846 2014 A homozygous PDE6D mutation in Joubert syndrome impairs targeting of farnesylated INPP5E protein to the primary cilium.
23698361 2013 Small molecule inhibition of the KRAS-PDE? interaction impairs oncogenic KRAS signalling.
23568457 2013 Genetic variants associated with disordered eating.
23559067 2013 The interplay between RPGR, PDE? and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
23301619 2013 Identification of PDE6D as a molecular target of anecortave acetate via a methotrexate-anchored yeast three-hybrid screen.
23150559 2012 ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
More...