Property Summary

Ligand Count 46
NCBI Gene PubMed Count 31
PubMed Score 30.60
PubTator Score 9.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.700 2.9e-02
non primary Sjogren syndrome sicca 1.200 1.4e-02
ovarian cancer 1.100 1.2e-03

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ      1 - 70
MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV     71 - 140
STSRVRLFYV                                                                141 - 150
//

Text Mined References (33)

PMID Year Title