Property Summary

NCBI Gene PubMed Count 27
PubMed Score 60.70
PubTator Score 24.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (11)

AA Sequence

MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLD      1 - 70
IYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGF     71 - 140
EFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTL    141 - 210
LGS                                                                       211 - 213
//

Text Mined References (27)

PMID Year Title