Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.29
PubTator Score 4.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 5.65133932198465E-5
Multiple myeloma 1328 1.70975679496387E-4
astrocytoma 1493 4.76744050698179E-4
Pneumonia 133 0.00498094315329754
Waldenstrons macroglobulinemia 765 0.00737335310924936
Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 37 4.788 2.4

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.162 0.007
Multiple myeloma 1.611 0.000
astrocytoma -1.300 0.000
Pneumonia -1.700 0.005
ovarian cancer 1.600 0.000

Synonym

Accession O43920
Symbols CI15K
CI-15k

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
21310150 This subunit of complex I is localized in the mitochondrial inter-membrane space. The protein contains intra-molecular disulfide bridges in the twin Cx(9)C motif. Does not contain an Fe-S cluster (despite what's suggested by the name).
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQ      1 - 70
KTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP                                       71 - 106
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21310150 2011 NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20818383 2010 High-throughput, pooled sequencing identifies mutations in NUBPL and FOXRED1 in human complex I deficiency.
19426391 2009 Analysis of whole genomic expression profiles of Helicobacter pylori related chronic atrophic gastritis with IL-1B-31CC/-511TT genotypes.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
More...