Property Summary

Ligand Count 1
NCBI Gene PubMed Count 19
PubMed Score 1.41
PubTator Score 4.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 3.7e-02
Multiple myeloma 1.611 1.7e-04
ovarian cancer 1.600 5.7e-05
Pneumonia -1.700 5.0e-03
Waldenstrons macroglobulinemia 1.162 7.4e-03

Gene RIF (4)

AA Sequence

MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQ      1 - 70
KTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP                                       71 - 106
//

Text Mined References (24)

PMID Year Title