Property Summary

NCBI Gene PubMed Count 166
PubMed Score 942.88
PubTator Score 699.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
psoriasis 6694 4.0e-32
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 3.0
Disease Target Count Z-score Confidence
Autoimmune polyendocrine syndrome type 1 9 0.0 5.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 4.0e-32

 GWAS Trait (1)

Gene RIF (153)

AA Sequence

MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQD      1 - 70
STAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARA     71 - 140
AAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGIL    141 - 210
IQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVP    211 - 280
APLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP    281 - 350
RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV    351 - 420
GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAP    421 - 490
SPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS                   491 - 545
//

Text Mined References (173)

PMID Year Title