Property Summary

NCBI Gene PubMed Count 127
PubMed Score 283.19
PubTator Score 215.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Breast cancer -3.000 4.3e-02
breast carcinoma -2.700 3.6e-06
colon cancer -1.900 7.8e-06
ductal carcinoma in situ -3.200 1.4e-04
group 3 medulloblastoma -1.100 3.1e-04
interstitial cystitis 2.100 9.6e-05
intraductal papillary-mucinous adenoma (... -1.500 6.7e-03
intraductal papillary-mucinous carcinoma... -1.600 8.4e-03
invasive ductal carcinoma -4.421 4.7e-06
lung adenocarcinoma -2.700 1.5e-14
lung cancer -2.600 1.1e-03
lung carcinoma -3.500 1.5e-16
malignant mesothelioma 1.500 1.2e-06
non-small cell lung cancer -4.432 8.9e-40
pituitary cancer -1.600 1.2e-06

Protein-protein Interaction (4)

Gene RIF (114)

AA Sequence

MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLR      1 - 70
LKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVF     71 - 140
RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIP    141 - 210
EEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKD    211 - 280
LIQHPKNCSCFECKESLETCCQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHS    281 - 350
RKNP                                                                      351 - 354
//

Text Mined References (129)

PMID Year Title