Property Summary

NCBI Gene PubMed Count 119
PubMed Score 266.91
PubTator Score 215.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 8.8857630454092E-40
lung adenocarcinoma 2714 1.07928087776245E-21
lung carcinoma 2844 1.52523557548799E-16
non-inflammatory breast cancer 208 2.75809719137647E-12
pituitary cancer 1972 1.15678445275531E-6
malignant mesothelioma 3163 1.15970736665222E-6
lung cancer 4473 1.45729429812857E-6
breast carcinoma 1614 3.55286874673321E-6
invasive ductal carcinoma 2950 4.67763171973042E-6
colon cancer 1475 7.82197652244087E-6
interstitial cystitis 2299 9.59045363744359E-5
ductal carcinoma in situ 1745 1.41123707512168E-4
group 3 medulloblastoma 2254 3.08877016721462E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00673414964389064
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00837399581442498
Disease Target Count Z-score Confidence
Lymphedema 26 5.199 2.6
Cancer 2346 4.84 2.4
Kidney angiomyolipoma 8 3.267 1.6

Expression

  Differential Expression (15)

Synonym

Accession O43915 B2R7Z3 VEGF-D
Symbols FIGF
VEGF-D

Gene

PANTHER Protein Class (2)

PDB

2XV7  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (106)

PMID Text
26884842 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.
26724950 Study demonstrated that VEGF-D upregulates myofibroblast proliferation, migration, and collagen synthesis through activation of VEGF pathway.
26706909 The most extensively accepted signaling pathways promoting lymphangiogenesis in tumors include the secreted lymphangiogenic proteins: VEGF-C and VEGF-D, and their cognate receptor on lymphatic endothelium VEGF receptor-3 (VEGFR-3).
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26296919 VEGF-C/D score correlated neither with periphery Lymphatic vessel density (LVD) nor with LVD in the tumor center
26241709 A positive association for VEGF-D and an inverse association for MMP-2 were observed in patients with positive lymph node status at the time of radical cystectomy in urothelial carcinoma of the bladder.
26125443 predictive value of VEGF-D expression for bevacizumab may depend on the chemotherapy backbone used
26121315 VEGF-D is involved in the development of lymphangiogenesis in peritoneal dialysis patients.
25911567 study suggests that both VEGF-C and VEGF-D in tumor cells promote lymph node metastasis
25891418 These findings suggest that IL-8 may be a potent inducer of LECs, although this effect does not appear to involve the VEGF-C/VEGF-D and VEGFR-3 signaling pathway.
More...

AA Sequence

MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLR      1 - 70
LKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVF     71 - 140
RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIP    141 - 210
EEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKD    211 - 280
LIQHPKNCSCFECKESLETCCQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHS    281 - 350
RKNP                                                                      351 - 354
//

Text Mined References (121)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26884842 2015 CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells.
26724950 2016 Vascular endothelial growth factor-D mediates fibrogenic response in myofibroblasts.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26296919 2015 Expression of VEGF-C/-D and lymphangiogenesis in salivary adenoid cystic carcinoma.
26241709 2015 High VEGF-D and Low MMP-2 Serum Levels Predict Nodal-Positive Disease in Invasive Bladder Cancer.
26125443 2015 Vascular endothelial growth factor D expression is a potential biomarker of bevacizumab benefit in colorectal cancer.
26121315 2015 Vascular endothelial growth factor receptor-3 is a novel target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury.
25911567 2015 Significance of Vascular Endothelial Growth Factor (VEGF)-C and VEGF-D in the Progression of Cutaneous Melanoma.
More...