Property Summary

NCBI Gene PubMed Count 119
Grant Count 46
R01 Count 24
Funding $3,631,064.07
PubMed Score 266.91
PubTator Score 215.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (106)

PMID Text
26884842 CCL21/CCR7 induce VEGF-D up-regulation and promote lymphangiogenesis via ERK/Akt pathway in lung cancer.
26724950 Study demonstrated that VEGF-D upregulates myofibroblast proliferation, migration, and collagen synthesis through activation of VEGF pathway.
26706909 The most extensively accepted signaling pathways promoting lymphangiogenesis in tumors include the secreted lymphangiogenic proteins: VEGF-C and VEGF-D, and their cognate receptor on lymphatic endothelium VEGF receptor-3 (VEGFR-3).
26543080 MTA1 is up-regulated in CRC; its expression is inversely associated with lymphatic metastases and the expression of VEGFC, VEGFD and VEGFR3
26296919 VEGF-C/D score correlated neither with periphery Lymphatic vessel density (LVD) nor with LVD in the tumor center
26241709 A positive association for VEGF-D and an inverse association for MMP-2 were observed in patients with positive lymph node status at the time of radical cystectomy in urothelial carcinoma of the bladder.
26125443 predictive value of VEGF-D expression for bevacizumab may depend on the chemotherapy backbone used
26121315 VEGF-D is involved in the development of lymphangiogenesis in peritoneal dialysis patients.
25911567 study suggests that both VEGF-C and VEGF-D in tumor cells promote lymph node metastasis
25891418 These findings suggest that IL-8 may be a potent inducer of LECs, although this effect does not appear to involve the VEGF-C/VEGF-D and VEGFR-3 signaling pathway.
More...

AA Sequence

MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSEDWKLWRCRLR      1 - 70
LKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVF     71 - 140
RCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRRSIQIP    141 - 210
EEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKD    211 - 280
LIQHPKNCSCFECKESLETCCQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHS    281 - 350
RKNP                                                                      351 - 354
//

Text Mined References (121)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26884842 2015 CCL21/CCR7 up-regulate vascular endothelial growth factor-D expression via ERK pathway in human non-small cell lung cancer cells.
26724950 2016 Vascular endothelial growth factor-D mediates fibrogenic response in myofibroblasts.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26543080 MTA1 Is Up-regulated in Colorectal Cancer and Is Inversely Correlated with Lymphatic Metastasis.
26296919 2015 Expression of VEGF-C/-D and lymphangiogenesis in salivary adenoid cystic carcinoma.
26241709 2015 High VEGF-D and Low MMP-2 Serum Levels Predict Nodal-Positive Disease in Invasive Bladder Cancer.
26125443 2015 Vascular endothelial growth factor D expression is a potential biomarker of bevacizumab benefit in colorectal cancer.
26121315 2015 Vascular endothelial growth factor receptor-3 is a novel target to improve net ultrafiltration in methylglyoxal-induced peritoneal injury.
25911567 2015 Significance of Vascular Endothelial Growth Factor (VEGF)-C and VEGF-D in the Progression of Cutaneous Melanoma.
More...