Property Summary

NCBI Gene PubMed Count 31
Grant Count 11
R01 Count 9
Funding $990,083.57
PubMed Score 31.36
PubTator Score 12.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.000 0.032
psoriasis -1.200 0.001
adrenocortical carcinoma 1.197 0.000
tuberculosis and treatment for 6 months -1.100 0.001
non-small cell lung cancer 1.238 0.000
lung cancer 1.700 0.007
group 3 medulloblastoma 1.100 0.004
Pick disease -1.200 0.003
ovarian cancer 1.600 0.001
dermatomyositis 1.200 0.003

Gene RIF (2)

PMID Text
20677014 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVFVNCVECFTLR      1 - 70
LLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTVYIVLDKAEYLRDMEANLLPG     71 - 140
FLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFPDYSIGNLQKILSHDHPPEYSADFYAAYINI    141 - 210
LLGVFYTVCRDLKELRHLAVLNFPKYCEPVVKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEK    211 - 280
LQKDDTDPGQLKGLSAHTHVELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNH    281 - 350
LLGPKPFPLDRLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA    351 - 420
RTVNFDIIKYLYDFL                                                           421 - 435
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
21269460 2011 Initial characterization of the human central proteome.
20932478 2010 A WD-repeat protein stabilizes ORC binding to chromatin.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19135898 2009 Purification of proteins associated with specific genomic Loci.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17716973 2007 ATP-dependent assembly of the human origin recognition complex.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15684404 2005 Involvement of human MCM8 in prereplication complex assembly by recruiting hcdc6 to chromatin.
More...