Property Summary

NCBI Gene PubMed Count 18
Grant Count 391
R01 Count 213
Funding $66,312,580.61
PubMed Score 4.40
PubTator Score 8.12

Knowledge Summary

Patent

No data available

Synonym

Accession O43908 O60851
Symbols NKG2F
NKG2-F

Gene

Gene RIF (7)

PMID Text
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
20811687 NKG2F was expressed on surface of human blood NK cells, and may be up-regulated at mRNA level and protein level after IL-2 or IL-15 stimulation.
20648603 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
18006695 Observational study of gene-disease association. (HuGE Navigator)
16397273 Observational study of gene-disease association. (HuGE Navigator)
15140575 NKG2F is expressed in NK cells and can associate with DAP12.

AA Sequence

MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRT     71 - 140
WEERVCWPVLRRTLICFL                                                        141 - 158
//

Text Mined References (19)

PMID Year Title
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
23291587 2013 Genome-wide association analysis identifies new susceptibility loci for Behçet's disease and epistasis between HLA-B*51 and ERAP1.
20811687 2010 Up-regulation of NKG2F receptor, a functionally unknown killer receptor, of human natural killer cells by interleukin-2 and interleukin-15.
20654155 2010 [Study on expression of natural killer (NK) cell C-type lectin-like receptors in nasal NK/T-cell lymphomas].
20648603 2010 Association of NKG2D genetic polymorphism with susceptibility to chronic hepatitis B in a Han Chinese population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18006695 2008 Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.
16541075 2006 The finished DNA sequence of human chromosome 12.
16397273 2006 Identification of the NKG2D haplotypes associated with natural cytotoxic activity of peripheral blood lymphocytes and cancer immunosurveillance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...