Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.20
PubTator Score 8.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.8e-04
glioblastoma 1.200 4.1e-02
pediatric high grade glioma 1.200 3.0e-02

Gene RIF (7)

AA Sequence

MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEK      1 - 70
LTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRT     71 - 140
WEERVCWPVLRRTLICFL                                                        141 - 158
//

Text Mined References (19)

PMID Year Title