Property Summary

NCBI Gene PubMed Count 18
PubMed Score 46.14
PubTator Score 19.20

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 7.5959621584431E-57
Breast cancer 3099 1.76127624005515E-13
fibroadenoma 557 1.19092058009687E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.72583921802471E-4
psoriasis 6685 5.0187472016832E-4
pancreatic cancer 2300 0.00110234889953661
interstitial cystitis 2299 0.00304675537970478
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00635783119316161
medulloblastoma, large-cell 6234 0.0374270826192088
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0383297030947565
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0427267428919005
Disease Target Count Z-score Confidence
Kidney disease 397 0.0 1.0


Gene RIF (6)

26358320 Taken together, our results demonstrated the deregulation of GAS2 in both AML and ALL and the requirement of GAS2-Calpain2 axis for the growth of leukemic cells.
25925944 Truncated HBx deregulates cell growth via direct silencing of GAS2 and thereby provides a survival advantage for pre-neoplastic hepatocytes to facilitate cancer development via TP53 signaling.
24465953 GAS2 is up-regulated in chronic myeloid leukemia cells.
20679491 Studies have identified a Gas2/calpain-dependent mechanism by which ICSBP influences beta-catenin activity in myeloid leukemia.
20677014 Observational study of gene-disease association. (HuGE Navigator)
15817486 Gas2DN can increase the activity of calpain and induce degradation of stabilized/mutated beta-catenin

AA Sequence

TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK                                         281 - 313

Text Mined References (22)

PMID Year Title
26358320 2015 GAS2-Calpain2 axis contributes to the growth of leukemic cells.
25925944 2015 Truncated HBx-dependent silencing of GAS2 promotes hepatocarcinogenesis through deregulation of cell cycle, senescence and p53-mediated apoptosis.
24465953 2014 Growth arrest specific 2 is up-regulated in chronic myeloid leukemia cells and required for their growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20679491 2010 Interferon consensus sequence binding protein (ICSBP) decreases beta-catenin activity in myeloid cells by repressing GAS2 transcription.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.