Property Summary

NCBI Gene PubMed Count 18
PubMed Score 49.02
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (6)

AA Sequence

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL      1 - 70
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK     71 - 140
QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS    141 - 210
EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK    211 - 280
TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK                                         281 - 313
//

Text Mined References (22)

PMID Year Title