Property Summary

NCBI Gene PubMed Count 18
Grant Count 8
R01 Count 7
Funding $501,855
PubMed Score 46.14
PubTator Score 19.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26358320 Taken together, our results demonstrated the deregulation of GAS2 in both AML and ALL and the requirement of GAS2-Calpain2 axis for the growth of leukemic cells.
25925944 Truncated HBx deregulates cell growth via direct silencing of GAS2 and thereby provides a survival advantage for pre-neoplastic hepatocytes to facilitate cancer development via TP53 signaling.
24465953 GAS2 is up-regulated in chronic myeloid leukemia cells.
20679491 Studies have identified a Gas2/calpain-dependent mechanism by which ICSBP influences beta-catenin activity in myeloid leukemia.
20677014 Observational study of gene-disease association. (HuGE Navigator)
15817486 Gas2DN can increase the activity of calpain and induce degradation of stabilized/mutated beta-catenin

AA Sequence

MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL      1 - 70
AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK     71 - 140
QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS    141 - 210
EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK    211 - 280
TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK                                         281 - 313
//

Text Mined References (22)

PMID Year Title
26358320 2015 GAS2-Calpain2 axis contributes to the growth of leukemic cells.
25925944 2015 Truncated HBx-dependent silencing of GAS2 promotes hepatocarcinogenesis through deregulation of cell cycle, senescence and p53-mediated apoptosis.
24465953 2014 Growth arrest specific 2 is up-regulated in chronic myeloid leukemia cells and required for their growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20679491 2010 Interferon consensus sequence binding protein (ICSBP) decreases beta-catenin activity in myeloid cells by repressing GAS2 transcription.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...