Property Summary

NCBI Gene PubMed Count 20
Grant Count 31
R01 Count 11
Funding $5,928,761.33
PubMed Score 23.37
PubTator Score 60.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.500 0.001
lung adenocarcinoma -1.400 0.000
group 3 medulloblastoma 1.400 0.013
non primary Sjogren syndrome sicca -1.200 0.021
lung carcinoma -1.300 0.000
non-small cell lung carcinoma -1.100 0.000
ovarian cancer -1.200 0.000

Gene RIF (11)

PMID Text
25233961 This SNP [TLL1 gene ]could not be confirmed as a risk factor for CHD [coronary heart disease]in T2DM [type-2 Diabetes mellitus]patients
24663101 Depletion of the TLL1 expression upregulates HIV-1 CA A92E mutant infectivity in CsA-untreated HeLa cells and downregulates its infectivity in CsA-treated HeLa cells
23726511 This study identified TLL1 as a new susceptibility gene for PTSD.
22883091 TLL-1 gene mutation with an insertion mutation of base A in exon 10 is common in Chinese patients with sporadic congenital heart diseases.
21911782 We identified a variant in a single PPAR pathway gene, TLL1, that is associated with the extent of coronary artery disease independently of clinical predictors, specifically in patients with type 2 diabetes mellitus.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20043912 Data demonstrate that TLL-1, which has intermediate activity, forms a calcium-ion dependent dimer with monomers stacked side-by-side.
19723501 These results indicate that the hypoxia responsive motif is directly involved in the activation of the mTll-1 transcription under hypoxic conditions.
18830233 Mutations in mammalian tolloid-like 1 gene detected in adult patients with Atrial septal defect
18824173 The crystal structures of the protease domains of human BMP-1 and the closely related Tolloid-like protease 1 (TLL-1), are reported.
More...

AA Sequence

MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDL      1 - 70
NIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQN     71 - 140
EKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPC    141 - 210
GCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKME    211 - 280
PGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACG    281 - 350
ETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL    351 - 420
GRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVW    421 - 490
KITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDG    491 - 560
TVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTIT    561 - 630
TPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEV    631 - 700
ITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCK    701 - 770
EAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETE    771 - 840
KSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNN    841 - 910
YPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDS    911 - 980
VLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK                                         981 - 1013
//

Text Mined References (21)

PMID Year Title
25233961 2014 Association of TLL1 gene polymorphism (rs1503298, T > C) with coronary heart disease in PREDICT, UDACS and ED cohorts.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23412934 2013 A genome-wide association study of brain lesion distribution in multiple sclerosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22883091 2012 [Metalloproteinase Tolloid-like 1 gene mutation in Chinese patients with sporadic congenital heart diseases].
21911782 2011 Peroxisome proliferator-activated receptor pathway gene polymorphism associated with extent of coronary artery disease in patients with type 2 diabetes in the bypass angioplasty revascularization investigation 2 diabetes trial.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20043912 2010 Structural and functional evidence for a substrate exclusion mechanism in mammalian tolloid like-1 (TLL-1) proteinase.
19723501 2009 Activation of mammalian Tolloid-like 1 expression by hypoxia in human neuroblastoma SH-SY5Y cells.
18830233 2009 Mutations in mammalian tolloid-like 1 gene detected in adult patients with ASD.
More...