Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
Funding $1,051,495.88
PubMed Score 32.17
PubTator Score 30.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -2.021 0.009
osteosarcoma 1.299 0.005
ulcerative colitis -1.200 0.000

Gene RIF (11)

PMID Text
23276181 A C-2399A SNP assay was applied to patients with acute hypotensive transfusion reactions. In a pilot study, 2 patients (50%) were found to possess C-2399A polymorphisms. One was found to be homozygous, and the other was heterozygous.
21898657 the genetic regulation of the XPNPEP2 gene and identify the genetic factors contributing to variance in plasma aminopeptidase P activity and ACEi-angioedema (XPNPEP2)
21052031 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625347 XPNPEP2 C-2399A polymorphism associates with angiotensin-converting enzyme inhibitor-associated angioedema in men but not women.
20625347 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19460752 Knockdown of X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound (XPNPEP2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19178938 females have polymorphisms associated with lower levels of APP & ACE; study suggests multiple genes may contribute to this disease
18515364 Structural comparisons suggest mechanisms for substrate selectivity in different X-prolyl peptidases.
18158172 Increase in aminopeptidase P levels brought on by androgens could contribute to a more effective control of the kinin accumulation considered to be responsible for the symptoms of angioedema.
17003818 We found significantly decreased plasma aminopeptidase P activity (P=0.013) in hypersensitivity reactions (HSR+) subjects as well as altered degradation of endogenous des-Arginine(9)-bradykinin.
More...

AA Sequence

MARAHWGCCPWLVLLCACAWGHTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYI      1 - 70
IPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPI     71 - 140
VTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEA    141 - 210
FTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKS    211 - 280
RFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPV    281 - 350
MMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETIS    351 - 420
ASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLS    421 - 490
RLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYK    491 - 560
DGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQ    561 - 630
RRQLLEEFEWLQQHTEPLAARAPDTASWASVLVVSTLAILGWSV                              631 - 674
//

Text Mined References (23)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23276181 2013 The development of a novel molecular assay examining the role of aminopeptidase P polymorphisms in acute hypotensive transfusion reactions.
21898657 2011 A functional XPNPEP2 promoter haplotype leads to reduced plasma aminopeptidase P and increased risk of ACE inhibitor-induced angioedema.
21082674 2010 Comprehensive analysis of low-abundance proteins in human urinary exosomes using peptide ligand library technology, peptide OFFGEL fractionation and nanoHPLC-chip-MS/MS.
21052031 2011 Identification of genetic factors associated with susceptibility to angiotensin-converting enzyme inhibitors-induced cough.
20625347 2010 Sex-dependent and race-dependent association of XPNPEP2 C-2399A polymorphism with angiotensin-converting enzyme inhibitor-associated angioedema.
19178938 2009 Genetic analysis of Factor XII and bradykinin catabolic enzymes in a family with estrogen-dependent inherited angioedema.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18515364 2008 Structure of human cytosolic X-prolyl aminopeptidase: a double Mn(II)-dependent dimeric enzyme with a novel three-domain subunit.
18158172 2008 Metallopeptidase activities in hereditary angioedema: effect of androgen prophylaxis on plasma aminopeptidase P.
More...