Property Summary

NCBI Gene PubMed Count 41
PubMed Score 45.66
PubTator Score 34.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.4e-05
psoriasis 6694 8.1e-05
osteosarcoma 7950 4.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrophy of breast 17 3.105 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.111 4.1e-04
ovarian cancer 1.400 3.4e-05
psoriasis 1.700 8.1e-05

Gene RIF (29)

AA Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSS      1 - 70
NPCLVHHDHTYSLPRETVSMDLGECEISLTGRTGFMGLAIHTFPFAESESCRKEGTQMTPQHMEELAEQE     71 - 140
IARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYT    141 - 210
AQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLP    211 - 280
AEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLE    281 - 350
WPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG                             351 - 395
//

Text Mined References (44)

PMID Year Title