Property Summary

NCBI Gene PubMed Count 35
Grant Count 17
R01 Count 4
Funding $1,667,648.01
PubMed Score 41.97
PubTator Score 34.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.111 0.000
ovarian cancer 1.400 0.000

 MGI Term (1)

Gene RIF (31)

PMID Text
25358080 INHA gene expression is upregulated by cAMP via CRE in human trophoblasts, and TFAP2 regulates this expression by interacting with CRE.
25077563 human sLZIP plays a critical role in development of atherosclerosis and can be used as a therapeutic target molecule for treatment of atherosclerosis
24481121 These results indicate that sLZIP plays a role in expression of c-Jun, and migration and invasion of cervical cancer cells via regulation of MMP-9 transcription.
24441043 Findings indicate that sLZIP negatively regulates AR transactivation in androgen-dependent PCa cells and functions as a positive regulator in tumor progression of androgen-independent PCa. sLZIP contributes to the malignant phenotype of PCa.
24185178 A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity.
23583719 propose that JAB1 is a novel binding partner of Luman, which negatively regulates the activity of Luman by promoting its degradation
23079381 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
23079381 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
23077317 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
23077317 The central region of luman (residues 100-314) and the residues 751 to 768 of HIV-1 gp41 are required for luman-Env interaction
More...

AA Sequence

MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSS      1 - 70
NPCLVHHDHTYSLPRETVSMDLGECEISLTGRTGFMGLAIHTFPFAESESCRKEGTQMTPQHMEELAEQE     71 - 140
IARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYT    141 - 210
AQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLP    211 - 280
AEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLE    281 - 350
WPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG                             351 - 395
//

Text Mined References (39)

PMID Year Title
25358080 2014 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25077563 2014 Human sLZIP promotes atherosclerosis via MMP-9 transcription and vascular smooth muscle cell migration.
24481121 2014 The role of sLZIP in transcriptional regulation of c-Jun and involvement in migration and invasion of cervical cancer cells.
24441043 2015 The role of sLZIP in cyclin D3-mediated negative regulation of androgen receptor transactivation and its involvement in prostate cancer.
24185178 2013 A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
23583719 2013 JAB1/CSN5 inhibits the activity of Luman/CREB3 by promoting its degradation.
23023215 2012 GSK3? and CREB3 gene expression profiling in benign and malignant salivary gland tumors.
22009750 2011 Human leucine zipper protein sLZIP induces migration and invasion of cervical cancer cells via expression of matrix metalloproteinase-9.
22004728 2012 Regulation of ADP-ribosylation factor 4 expression by small leucine zipper protein and involvement in breast cancer cell migration.
20546900 2010 DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation.
More...