Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 33.12

Knowledge Summary

Patent (336)

AA Sequence

MWQEYYFLNVFFPLLKVCCLTINSHVVILLPWECYHLIWKILPYIGTTVGSMEEYNTSSTDFTFMGLFNR      1 - 70
KETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYFLLSHLSLIDMMYISTIVPKMLVNYLLDQR     71 - 140
TISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPLRYPVLMSRRVCWMIIAGSWFGGSLDGFLLT    141 - 210
PITMSFPFCNSREINHFFCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSS    211 - 280
VEGRKKAFATCSSHMTVVSLFYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGA    281 - 350
LKRALGRFKGPQRVSGGVF                                                       351 - 369
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.