Property Summary

NCBI Gene PubMed Count 29
Grant Count 9
R01 Count 9
Funding $1,496,343.83
PubMed Score 62.77
PubTator Score 56.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 2.300 0.048
diabetes mellitus 1.100 0.001

Gene RIF (20)

PMID Text
23195617 association between ribavirin (RBV) serum levels and SLC28A2 rs11854484 genotype, as well as the replicated association of ITPA and SLC28A3 genetic polymorphisms with RBV-induced anemia and treatment response
23149444 genetic association studies in population in Italy: Data suggest that 3 SNPs (SLC28A2 rs11854484; IL28B, rs8099917; CYP27B1, rs4646536) are associated with pharmacokinetics of ribavirin and thus, sustained virologic response in hepatitis C patients.
20506327 These findings support the theory that CNT2 plays roles other than salvage and establishes links with energy metabolism.
20392501 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20028759 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19098160 Single nucleotide polymorphisms of this protein may play a role in variation in the pharmacokinetics and pharmacological effects of nucleoside analogs.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18635603 Report expression and hepatobiliary transport characteristics of CNT2 in sandwich-cultured human hepatocytes.
17926640 These data suggest that selected genes of the SLC28 and SLC29 families are not only targets of HIV-1 infection, but might also contribute to the development of adipose tissue alterations leading to lipodystrophy.
More...

AA Sequence

MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFC      1 - 70
KTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVHSFLKKLLGKKLTRCLKPFEN     71 - 140
SRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSKHHSAVSWRTVFSGLGLQF    141 - 210
VFGILVIRTDLGYTVFQWLGEQVQIFLNYTVAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGL    211 - 280
VQWVVQKVAWFLQITMGTTATETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLG    281 - 350
AFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLA    351 - 420
TNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFI    421 - 490
NEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDL    491 - 560
SKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPS    561 - 630
FSGPWEDKEFSAMALTNCCGFYNNTVCA                                              631 - 658
//

Text Mined References (30)

PMID Year Title
23195617 2013 Impact of genetic SLC28 transporter and ITPA variants on ribavirin serum level, hemoglobin drop and therapeutic response in patients with HCV infection.
23149444 2012 Negative predictive value of IL28B, SLC28A2, and CYP27B1 SNPs and low RBV plasma exposure for therapeutic response to PEG/IFN-RBV treatment.
22229870 2012 Genome-wide association of serum uric acid concentration: replication of sequence variants in an island population of the Adriatic coast of Croatia.
20506327 2010 Link between high-affinity adenosine concentrative nucleoside transporter-2 (CNT2) and energy metabolism in intestinal and liver parenchymal cells.
20392501 2010 Contribution of adenosine related genes to the risk of depression with disturbed sleep.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20028759 2010 Single nucleotide polymorphisms of gemcitabine metabolic genes and pancreatic cancer survival and drug toxicity.
19098160 2009 Identification and characterization of proximal promoter polymorphisms in the human concentrative nucleoside transporter 2 (SLC28A2).
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18635603 2008 Expression and hepatobiliary transport characteristics of the concentrative and equilibrative nucleoside transporters in sandwich-cultured human hepatocytes.
More...