Property Summary

Ligand Count 4
NCBI Gene PubMed Count 30
PubMed Score 73.18
PubTator Score 56.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hyperuricemia 47 3.432 1.7
Cerebral artery occlusion 2 3.176 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 2.300 4.8e-02

Synonym

Accession O43868 A8K7F9 O43239 Q52LZ0
Symbols CNT2
HCNT2
SPNT1
HsT17153

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

AA Sequence

MEKASGRQSIALSTVETGTVNPGLELMEKEVEPEGSKRTDAQGHSLGDGLGPSTYQRRSRWPFSKARSFC      1 - 70
KTHASLFKKILLGLLCLAYAAYLLAACILNFQRALALFVITCLVIFVLVHSFLKKLLGKKLTRCLKPFEN     71 - 140
SRLRLWTKWVFAGVSLVGLILWLALDTAQRPEQLIPFAGICMFILILFACSKHHSAVSWRTVFSGLGLQF    141 - 210
VFGILVIRTDLGYTVFQWLGEQVQIFLNYTVAGSSFVFGDTLVKDVFAFQALPIIIFFGCVVSILYYLGL    211 - 280
VQWVVQKVAWFLQITMGTTATETLAVAGNIFVGMTEAPLLIRPYLGDMTLSEIHAVMTGGFATISGTVLG    281 - 350
AFIAFGVDASSLISASVMAAPCALASSKLAYPEVEESKFKSEEGVKLPRGKERNVLEAASNGAVDAIGLA    351 - 420
TNVAANLIAFLAVLAFINAALSWLGELVDIQGLTFQVICSYLLRPMVFMMGVEWTDCPMVAEMVGIKFFI    421 - 490
NEFVAYQQLSQYKNKRLSGMEEWIEGEKQWISVRAEIITTFSLCGFANLSSIGITLGGLTSIVPHRKSDL    491 - 560
SKVVVRALFTGACVSLISACMAGILYVPRGAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPS    561 - 630
FSGPWEDKEFSAMALTNCCGFYNNTVCA                                              631 - 658
//

Text Mined References (31)

PMID Year Title