Property Summary

NCBI Gene PubMed Count 28
PubMed Score 70.46
PubTator Score 22.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
non-small cell lung carcinoma 317 1.2e-24
lung adenocarcinoma 2716 6.4e-15
osteosarcoma 7950 1.1e-14
lung carcinoma 2843 8.4e-08
lung cancer 4740 3.4e-05
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Hereditary elliptocytosis 22 6.814 3.4

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus 1.300 1.0e-03
lung adenocarcinoma -1.100 6.4e-15
lung cancer -2.800 3.4e-05
lung carcinoma -1.300 8.4e-08
non-small cell lung carcinoma -1.300 1.2e-24
osteosarcoma -5.021 1.1e-14

Gene RIF (17)

AA Sequence

MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCRELGCGAA      1 - 70
SGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL     71 - 140
ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSG    141 - 210
REATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQV    211 - 280
VCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG       281 - 347
//

Text Mined References (32)

PMID Year Title