Property Summary

NCBI Gene PubMed Count 28
Grant Count 14
R01 Count 7
Funding $1,835,382.92
PubMed Score 64.42
PubTator Score 22.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -5.021 0.000
lung cancer -2.800 0.000
diabetes mellitus 1.300 0.001
lung adenocarcinoma -1.300 0.000
lung carcinoma -1.300 0.000
non-small cell lung carcinoma -1.300 0.000

Gene RIF (17)

PMID Text
26726878 AIM enhances intratubular debris clearance and ameliorates acute kidney injury via interaction with KIM-1.
26135353 The present study provides the first evidence that apoptosis inhibitor of macrophages binds to IGFBP2, 3 and 4.
26048980 CD5L is a key protein in the control of immune homeostasis and inflammatory disease. (Review)
25713983 CD36 is involved in autophagy; the CD5L-CD36 axis has a role in the induction of macrophage autophagy
25302503 Apoptosis inhibitor of macrophage levels were markedly higher in patients with advanced liver damage, regardless of disease type, and correlated significantly with multiple parameters representing liver function.
24295828 Our data represent the first evidence that human AIM is involved in macrophage survival, adhesion, and foam cell formation
24223991 AIM contributes to key macrophage responses to M. tuberculosis
23236605 N-glycosylation plays important roles in the secretion and lipolytic function of AIM
21970839 AIM is involved in the progression of MetS in both an advancing and inhibitory fashion. Regulation of AIM could therefore be therapeutically applicable for MetS.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MALLFSLILAICTRPGFLASPSGVRLVGGLHRCEGRVEVEQKGQWGTVCDDGWDIKDVAVLCRELGCGAA      1 - 70
SGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDCSHDEDAGASCENPESSFSPVPEGVRL     71 - 140
ADGPGHCKGRVEVKHQNQWYTVCQTGWSLRAAKVVCRQLGCGRAVLTQKRCNKHAYGRKPIWLSQMSCSG    141 - 210
REATLQDCPSGPWGKNTCNHDEDTWVECEDPFDLRLVGGDNLCSGRLEVLHKGVWGSVCDDNWGEKEDQV    211 - 280
VCKQLGCGKSLSPSFRDRKCYGPGVGRIWLDNVRCSGEEQSLEQCQHRFWGFHDCTHQEDVAVICSG       281 - 347
//

Text Mined References (32)

PMID Year Title
26726878 2016 Apoptosis inhibitor of macrophage protein enhances intraluminal debris clearance and ameliorates acute kidney injury in mice.
26135353 2015 Interaction of AIM with insulin-like growth factor-binding protein-4.
26048980 2015 AIM/CD5L: a key protein in the control of immune homeostasis and inflammatory disease.
25713983 2015 The human CD5L/AIM-CD36 axis: A novel autophagy inducer in macrophages that modulates inflammatory responses.
25302503 2014 Circulating AIM as an indicator of liver damage and hepatocellular carcinoma in humans.
24804991 2014 Stabilization and augmentation of circulating AIM in mice by synthesized IgM-Fc.
24583716 2014 The macrophage soluble receptor AIM/Api6/CD5L displays a broad pathogen recognition spectrum and is involved in early response to microbial aggression.
24295828 2014 Human scavenger protein AIM increases foam cell formation and CD36-mediated oxLDL uptake.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223991 2013 The scavenger protein apoptosis inhibitor of macrophages (AIM) potentiates the antimicrobial response against Mycobacterium tuberculosis by enhancing autophagy.
More...