Property Summary

NCBI Gene PubMed Count 31
Grant Count 24
R01 Count 22
Funding $2,412,612.58
PubMed Score 43.23
PubTator Score 26.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.342 0.000
group 4 medulloblastoma -2.000 0.000
glioblastoma -1.200 0.015
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.400 0.001
ulcerative colitis -1.201 0.028
acute quadriplegic myopathy 1.240 0.000
subependymal giant cell astrocytoma -1.215 0.014
lung adenocarcinoma 1.170 0.000
ovarian cancer 2.300 0.000
Down syndrome 1.700 0.001

Gene RIF (14)

PMID Text
26509711 IRBIT forms signaling complexes with PIPKIalpha and NBCe1-B, whose activity is regulated by PI(4,5)P2.
25237103 Formation of the Ribonucleotide reductase-IRBIT complex is regulated through phosphorylation of IRBIT, and ablation of IRBIT expression in HeLa cells causes imbalanced dNTP pools and altered cell cycle progression.
24518248 IRBIT is a master regulator of ion channels and ion transporters. (Review)
24489003 HIV-1 Tat modulates IRBIT expression in neuron cells
23769829 IRBIT plays an important role in intracellular pH regulation, mediated by NHE3, and further regulated by SPAK.
23431199 relationships between the WNK/SPAK and IRBIT/PP1 sites in the regulation of Na+-HCO3- cotransporters
22826361 conclude that AHCYL1 expression is associated with ovarian carcinogenesis as an oncogene in chickens, whereas it plays the role of tumor suppressor in human EOC, suggesting a paradoxical function of AHCYL1 in ovarian carcinogenesis
22012331 A NBCe1-B construct that lacks amino acid residues 2-16 of the amino-terminus is fully autoinhibited, but cannot be stimulated by IRBIT, indicating that autoinhibitory and IRBIT-binding determinants within the cytosolic amino-terminus are not identical.
21956116 HIV-1 Tat modulates IRBIT expression in neuron cells
21317537 IRBIT opposes the effects of WNKs and SPAK by recruiting PP1 to the complex to dephosphorylate CFTR and NBCe1-B, restoring their cell surface expression, in addition to stimulating their activities
More...

AA Sequence

MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS      1 - 70
STDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGE     71 - 140
KPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW    141 - 210
CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVND    211 - 280
SVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA    281 - 350
CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR    351 - 420
SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE    421 - 490
YVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY                                  491 - 530
//

Text Mined References (38)

PMID Year Title
26509711 2015 IRBIT Interacts with the Catalytic Core of Phosphatidylinositol Phosphate Kinase Type I? and II? through Conserved Catalytic Aspartate Residues.
25416956 2014 A proteome-scale map of the human interactome network.
25237103 2014 Enzyme regulation. IRBIT is a novel regulator of ribonucleotide reductase in higher eukaryotes.
24518248 2014 IRBIT: a regulator of ion channels and ion transporters.
23769829 2013 IRBIT plays an important role in NHE3-mediated pHi regulation in HSG cells.
23431199 2013 Convergence of IRBIT, phosphatidylinositol (4,5) bisphosphate, and WNK/SPAK kinases in regulation of the Na+-HCO3- cotransporters family.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22826361 2012 Paradoxical expression of AHCYL1 affecting ovarian carcinogenesis between chickens and women.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...