Property Summary

NCBI Gene PubMed Count 31
PubMed Score 43.23
PubTator Score 26.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 5.6123543096767E-7
group 4 medulloblastoma 1875 1.7322849228728E-6
lung adenocarcinoma 2714 3.44798762435246E-6
atypical teratoid / rhabdoid tumor 4369 5.16337104496286E-6
medulloblastoma, large-cell 6234 9.89569879471566E-5
acute quadriplegic myopathy 1157 2.49001767839797E-4
osteosarcoma 7933 3.05826315787684E-4
Down syndrome 548 6.0666443626868E-4
primitive neuroectodermal tumor 3031 0.00136792182237529
subependymal giant cell astrocytoma 2287 0.0139286653233771
glioblastoma 5572 0.0154321790718855
ulcerative colitis 2087 0.0277239004887191
Disease Target Count Z-score Confidence
Gingival recession 14 3.389 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.342 0.000
group 4 medulloblastoma -2.000 0.000
glioblastoma -1.200 0.015
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -2.200 0.000
primitive neuroectodermal tumor -1.400 0.001
ulcerative colitis -1.201 0.028
acute quadriplegic myopathy 1.240 0.000
subependymal giant cell astrocytoma -1.215 0.014
lung adenocarcinoma 1.170 0.000
ovarian cancer 2.300 0.000
Down syndrome 1.700 0.001

Synonym

Accession O43865 B4E168 Q2TAJ6 Q502W8 Q5VSM0 Q6P171 Q96PK4 Q9UG84 AdoHcyase 2
Symbols DCAL
IRBIT
PPP1R78
PRO0233
XPVKONA

Gene

PANTHER Protein Class (1)

PDB

3MTG  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (14)

PMID Text
26509711 IRBIT forms signaling complexes with PIPKIalpha and NBCe1-B, whose activity is regulated by PI(4,5)P2.
25237103 Formation of the Ribonucleotide reductase-IRBIT complex is regulated through phosphorylation of IRBIT, and ablation of IRBIT expression in HeLa cells causes imbalanced dNTP pools and altered cell cycle progression.
24518248 IRBIT is a master regulator of ion channels and ion transporters. (Review)
24489003 HIV-1 Tat modulates IRBIT expression in neuron cells
23769829 IRBIT plays an important role in intracellular pH regulation, mediated by NHE3, and further regulated by SPAK.
23431199 relationships between the WNK/SPAK and IRBIT/PP1 sites in the regulation of Na+-HCO3- cotransporters
22826361 conclude that AHCYL1 expression is associated with ovarian carcinogenesis as an oncogene in chickens, whereas it plays the role of tumor suppressor in human EOC, suggesting a paradoxical function of AHCYL1 in ovarian carcinogenesis
22012331 A NBCe1-B construct that lacks amino acid residues 2-16 of the amino-terminus is fully autoinhibited, but cannot be stimulated by IRBIT, indicating that autoinhibitory and IRBIT-binding determinants within the cytosolic amino-terminus are not identical.
21956116 HIV-1 Tat modulates IRBIT expression in neuron cells
21317537 IRBIT opposes the effects of WNKs and SPAK by recruiting PP1 to the complex to dephosphorylate CFTR and NBCe1-B, restoring their cell surface expression, in addition to stimulating their activities
More...

AA Sequence

MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQS      1 - 70
STDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGE     71 - 140
KPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWW    141 - 210
CIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVND    211 - 280
SVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA    281 - 350
CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVR    351 - 420
SQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDE    421 - 490
YVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY                                  491 - 530
//

Text Mined References (38)

PMID Year Title
26509711 2015 IRBIT Interacts with the Catalytic Core of Phosphatidylinositol Phosphate Kinase Type I? and II? through Conserved Catalytic Aspartate Residues.
25416956 2014 A proteome-scale map of the human interactome network.
25237103 2014 Enzyme regulation. IRBIT is a novel regulator of ribonucleotide reductase in higher eukaryotes.
24518248 2014 IRBIT: a regulator of ion channels and ion transporters.
23769829 2013 IRBIT plays an important role in NHE3-mediated pHi regulation in HSG cells.
23431199 2013 Convergence of IRBIT, phosphatidylinositol (4,5) bisphosphate, and WNK/SPAK kinases in regulation of the Na+-HCO3- cotransporters family.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22826361 2012 Paradoxical expression of AHCYL1 affecting ovarian carcinogenesis between chickens and women.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...