Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.74
PubTator Score 26.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.200 0.001
osteosarcoma -1.936 0.000
cystic fibrosis 1.077 0.002
medulloblastoma, large-cell -1.500 0.004
tuberculosis and treatment for 6 months -1.600 0.004
ovarian cancer -2.100 0.000

Synonym

Accession O43861 O60872 Q08AD8 Q08AD9
Symbols NEO1L
hMMR1
ATPIIB
ATPASEP
HUSSY-20

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
22525042 These results revealed that human human macrophage MHC receptor 1 on monocytes is a novel receptor specific for HLA-B44.
19460752 Knockdown of ATPase, class II, type 9B (ATP9B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYH      1 - 70
TLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKY     71 - 140
NVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKE    141 - 210
VNSQLYSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVA    211 - 280
VSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVV    281 - 350
IYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYII    351 - 420
PISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSY    421 - 490
GADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYES    491 - 560
RAGVTEETEFAEADQDFSDENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQL    561 - 630
FPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQY    631 - 700
QDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKL    701 - 770
ETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQ    771 - 840
CPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQF    841 - 910
RHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFS    911 - 980
LVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTAL    981 - 1050
ILTELLMVALTVRTWHWLMVVAEFLSLGCYVSSLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAIT   1051 - 1120
VVSCLPLYVLKYLRRKLSPPSYCKLAS                                              1121 - 1147
//

Text Mined References (10)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22525042 2012 Specific binding of HLA-B44 to human macrophage MHC receptor 1 on monocytes.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11124703 2001 Characterization of 16 novel human genes showing high similarity to yeast sequences.
11015572 1999 Differential expression of putative transbilayer amphipath transporters.
9548971 1998 Multiple members of a third subfamily of P-type ATPases identified by genomic sequences and ESTs.