Property Summary

NCBI Gene PubMed Count 26
PubMed Score 93.08
PubTator Score 57.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Degenerative polyarthritis 93
Disease Target Count P-value
non-small cell lung carcinoma 413 9.16155575164951E-11
astrocytoma 1493 1.44728632366193E-9
psoriasis 6685 2.40624170398247E-9
lung carcinoma 2844 6.47159463130784E-9
oligodendroglioma 2849 3.45240105013612E-8
lung adenocarcinoma 2714 1.32335251974331E-6
atypical teratoid/rhabdoid tumor 1095 1.39952389605778E-6
active ulcerative colitis 477 3.22457770367537E-4
group 4 medulloblastoma 1875 5.08886436366914E-4
urothelial carcinoma 318 5.30665949794672E-4
Atopic dermatitis 944 7.05958219130824E-4
primary pancreatic ductal adenocarcinoma 1271 9.77472515981594E-4
invasive ductal carcinoma 2950 0.00104355572064166
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0013147343730592
Down syndrome 548 0.00155169641769713
pediatric high grade glioma 2712 0.00159866514205727
pancreatic cancer 2300 0.00216808947082997
colon cancer 1475 0.00364478312820667
active Crohn's disease 918 0.00438261397625239
glioblastoma 5572 0.00531198524001826
Pick disease 1893 0.00542612652445398
interstitial cystitis 2299 0.00626708946512864
osteosarcoma 7933 0.00722961039591394
progressive supranuclear palsy 674 0.00738133196735878
adrenocortical carcinoma 1427 0.0135421126506822
cystic fibrosis 1670 0.0149122347228966
pituitary cancer 1972 0.0152916049625112
ependymoma 2514 0.0155337237926381
medulloblastoma, large-cell 6234 0.0230534019662074
head and neck cancer 270 0.023749012950628
uncontrolled asthma 67 0.0270878747487508
Breast cancer 3099 0.027541993156518
subependymal giant cell astrocytoma 2287 0.0302540116886631
Disease Target Count Z-score Confidence
Intermittent claudication 16 3.118 1.6

Expression

  Differential Expression (33)

Disease log2 FC p
urothelial carcinoma 2.800 0.001
uncontrolled asthma -1.200 0.027
astrocytoma -1.700 0.000
glioblastoma -3.000 0.005
oligodendroglioma -1.900 0.000
osteosarcoma 2.334 0.007
ependymoma -1.800 0.016
atypical teratoid/rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -1.900 0.023
autosomal dominant Emery-Dreifuss muscul... 1.779 0.001
Atopic dermatitis -1.100 0.001
adrenocortical carcinoma -2.048 0.014
primary pancreatic ductal adenocarcinoma 3.321 0.001
colon cancer -1.600 0.004
active Crohn's disease -1.533 0.004
active ulcerative colitis -4.805 0.000
pancreatic cancer 3.200 0.002
Breast cancer 2.800 0.028
interstitial cystitis -1.100 0.006
cystic fibrosis 1.800 0.015
lung adenocarcinoma -1.200 0.000
pediatric high grade glioma -2.500 0.002
group 4 medulloblastoma 2.700 0.001
psoriasis -1.400 0.000
subependymal giant cell astrocytoma -3.165 0.030
invasive ductal carcinoma 2.889 0.001
lung carcinoma -1.600 0.000
non-small cell lung carcinoma -1.100 0.000
Pick disease -1.600 0.005
progressive supranuclear palsy -2.000 0.007
pituitary cancer 1.200 0.015
Down syndrome 1.400 0.002
head and neck cancer -1.300 0.024

Synonym

Accession O43854 B2R763 O43855 Q5D094 Q8N610
Symbols DEL1

Gene

PDB

4D90  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (16)

PMID Text
26735172 Overexpressed EDIL3 promotes anchorage-independent tumor growth in human pancreatic cancer.
26545781 Overexpression of the Del-1 gene potentiates proliferation and invasion of lung carcinoma cells.
25273699 The importance of interaction between EDIL3 and integrin alphaV.
24416060 The reciprocal regulation between Del-1 and inflammation may contribute to optimally balance the protective and the potentially harmful effects of inflammatory cell recruitment.
23364949 Del-1 may act as a gatekeeper of adrenal gland inflammation and may regulate the integrity of the hypothalamic-pituitary-adrenal axis stress response, thereby modulating adrenal (dys)function in the course of SIRS.
22601780 database search for EGF domain sequences shows that this RGD finger is likely an evolutionary insertion and unique to the EGF domain of Del-1
22388320 Del-1 mediates phosphatidylserine- and integrin-dependent endothelial uptake of microparticles by endocytosis.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20857535 High expression level of EDIL3 predicts poor prognosis of hepatocellular carcinoma patients.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEE      1 - 70
EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVAN     71 - 140
YSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAEN    141 - 210
DRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTP    211 - 280
YANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFT    281 - 350
WEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWT    351 - 420
VYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE              421 - 480
//

Text Mined References (28)

PMID Year Title
26735172 2016 Overexpressed EDIL3 predicts poor prognosis and promotes anchorage-independent tumor growth in human pancreatic cancer.
26545781 2015 Del-1 overexpression potentiates lung cancer cell proliferation and invasion.
25273699 2014 Elevated autocrine EDIL3 protects hepatocellular carcinoma from anoikis through RGD-mediated integrin activation.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24416060 2013 Expression and function of the homeostatic molecule Del-1 in endothelial cells and the periodontal tissue.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
More...