Property Summary

NCBI Gene PubMed Count 52
PubMed Score 66.04
PubTator Score 40.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease 1.126 9.1e-03
adrenocortical carcinoma 1.192 7.8e-04
astrocytic glioma -1.300 5.5e-03
Astrocytoma, Pilocytic 1.300 4.0e-04
atypical teratoid / rhabdoid tumor 1.600 3.1e-04
Breast cancer 2.500 3.2e-02
cystic fibrosis -1.642 4.9e-05
diabetes mellitus -1.600 5.9e-03
ependymoma 1.100 6.6e-03
glioblastoma 1.100 4.2e-05
interstitial cystitis 1.200 1.3e-04
intraductal papillary-mucinous carcinoma... 1.100 2.6e-02
lung adenocarcinoma 1.263 2.1e-06
lung cancer 1.200 4.0e-04
malignant mesothelioma -1.100 1.9e-05
medulloblastoma, large-cell 1.200 1.9e-03
non-small cell lung cancer 1.258 1.5e-16
oligodendroglioma 1.200 4.4e-03
osteosarcoma 2.678 5.5e-06
ovarian cancer 2.400 5.1e-06
pediatric high grade glioma 1.300 4.5e-05
pituitary cancer -1.300 6.2e-04
psoriasis -2.000 9.9e-05
sonic hedgehog group medulloblastoma 1.100 1.9e-02
tuberculosis and treatment for 6 months 1.300 1.2e-04
ulcerative colitis 1.800 7.9e-07

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (28)

AA Sequence

MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK      1 - 70
ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD     71 - 140
PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL    141 - 210
EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN    211 - 280
KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF                                       281 - 315
//

Text Mined References (62)

PMID Year Title