Property Summary

NCBI Gene PubMed Count 49
Grant Count 51
R01 Count 28
Funding $3,782,541.02
PubMed Score 61.38
PubTator Score 40.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -1.300 0.006
ependymoma 1.600 0.000
oligodendroglioma -1.400 0.006
psoriasis -2.000 0.000
glioblastoma 1.800 0.002
osteosarcoma 3.659 0.000
cystic fibrosis -1.642 0.000
atypical teratoid/rhabdoid tumor 1.800 0.000
medulloblastoma, large-cell 1.200 0.002
adrenocortical carcinoma 1.582 0.002
tuberculosis and treatment for 6 months 1.300 0.000
non-small cell lung cancer 1.662 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.026
lung cancer 1.200 0.000
active Crohn's disease 1.274 0.007
diabetes mellitus -1.600 0.006
Breast cancer 2.500 0.032
interstitial cystitis 1.200 0.000
pediatric high grade glioma 1.900 0.000
pilocytic astrocytoma 1.300 0.000
sonic hedgehog group medulloblastoma 1.100 0.019
lung adenocarcinoma 1.268 0.000
ulcerative colitis 1.800 0.000
ovarian cancer 2.400 0.000
pituitary cancer -1.300 0.001

Gene

 GO Function (1)

Gene RIF (25)

PMID Text
26124285 Results provide direct evidence for the involvement of CALU and LGALS3BP as potential negative regulators in the virus-triggered induction of the typeI interferons.
25963840 Results show that OSBPL5 and CALU were expressed at higher levels in the lung tissues of metastasis-positive cases than that in the metastasis-negative cases suggesting they can promote invasiveness of lung cancer cells.
25823396 CALU polymorphism A29809G affects calumenin availability involving vascular calcification
25120007 Calumenin is characterized as a charged protein exhibiting close similarity with intrinsically disordered proteins and is hypothesized to regulate F508del-CFTR folding by electrostatic effects.
22768251 Calumenin is a new CFTR chaperone.
22514732 Study found the secretion of calu-1/2-EGFP required microtubule integrity, and that calu-1/2-EGFP-containing vesicles were transported by the motor proteins Kif5b and cytoplasmic dynein.
22190034 HIV-1 gp120 is identified to have a physical interaction with calumenin (CALU) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22188360 Quantitative PCR assays for VKORC1, CYP4F2, GGCX and CALU identified two copies in all populations.
21057703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20673165 associated with arterial calcification and short-term prognosis of the outcome of patients with non-ST-elevation acute coronary syndrome
More...

AA Sequence

MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK      1 - 70
ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD     71 - 140
PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL    141 - 210
EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN    211 - 280
KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF                                       281 - 315
//

Text Mined References (59)

PMID Year Title
26124285 2015 Quantitative Proteomics Reveals the Roles of Peroxisome-associated Proteins in Antiviral Innate Immune Responses.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25963840 2015 Identification and evaluation of metastasis-related proteins, oxysterol binding protein-like 5 and calumenin, in lung tumors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823396 2015 CALU polymorphism A29809G affects calumenin availability involving vascular calcification.
25416956 2014 A proteome-scale map of the human interactome network.
25120007 2014 Biophysical characterisation of calumenin as a charged F508del-CFTR folding modulator.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...