Property Summary

NCBI Gene PubMed Count 29
PubMed Score 49.91
PubTator Score 34.88

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.05531215505174E-6
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 2.0
Disease Target Count Z-score Confidence
Differentiating neuroblastoma 2 3.623 1.8


  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 0.000


Accession O43847 A6NI41 O15241 O15242 Q5VUL0 Q96HB2 Q9NU57
Symbols NRD1


  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (19)

24168165 MRNA expression of NRD1 was upregulated in 56% of ESCC tissue samples.
23604405 possible roles of nardilysin in Alzheimer disease, Down syndrome, schizophrenia, mood disorders, alcohol abuse, heroin addiction and cancer; show that nardilysin is a Janus-faced enzyme with regard to brain pathology-- probably neuropathogenic in some diseases, but neuroprotective in others [review]
23219461 This study demonistrated that alcohol-dependent reduction of nardilysin in cell culture and nervous tissue points to an implication of the enzyme in the pathophysiology of alcoholism.
22653443 NRD1 interacts with p53 mutant R273H
22351606 These results demonstrate that gastric cancer cell growth is maintained by autonomous TNF-alpha-NF-kappaB and IL-6-STAT3 signalling, and that NRDc and ADAM proteases turn on these signalling cascades by stimulating ectodomain shedding of TNF-alpha.
22294699 Identification and characterization of nardilysin as a novel dimethyl H3K4-binding protein involved in transcriptional regulation.
22174317 HIV-1 Rev interacting protein, nardilysin (N-arginine dibasic convertase) (NRD1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with NRD1 is decreased by RRE
21972134 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-alpha1 (ADAP1).
21801775 SH-SY5Y cells, stably transfected with green fluorescent protein-tagged-p42(IP4) show enhanced NRD protein expression already at an earlier time point after retinoic acid stimulation.
21703634 Several flanking SNPs of the top hits in the meta-analysis demonstrated borderline associations with alcohol dependence in the family sample for KIAA0040, NRD1 and THSD7B, respectively.

AA Sequence

PLLADCIIPITDIRAFTTTLNLLPYHKIVK                                           1121 - 1150

Text Mined References (36)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24168165 2014 NRD1, which encodes nardilysin protein, promotes esophageal cancer cell invasion through induction of MMP2 and MMP3 expression.
23604405 2013 Nardilysin in human brain diseases: both friend and foe.
23219461 2013 Decreased expression of nardilysin in SH-SY5Y cells under ethanol stress and reduced density of nardilysin-expressing neurons in brains of alcoholics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22653443 2012 Mutant p53 interactome identifies nardilysin as a p53R273H-specific binding partner that promotes invasion.
22351606 2012 Nardilysin and ADAM proteases promote gastric cancer cell growth by activating intrinsic cytokine signalling via enhanced ectodomain shedding of TNF-?.
22294699 2012 Identification and characterization of nardilysin as a novel dimethyl H3K4-binding protein involved in transcriptional regulation.
21972134 2011 Tubulin potentiates the interaction of the metalloendopeptidase nardilysin with the neuronal scaffold protein p42IP4/centaurin-?1 (ADAP1).
21801775 2011 Retinoic acid-induced upregulation of the metalloendopeptidase nardilysin is accelerated by co-expression of the brain-specific protein p42(IP4) (centaurin ? 1; ADAP1) in neuroblastoma cells.