Property Summary

NCBI Gene PubMed Count 31
PubMed Score 55.04
PubTator Score 34.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Alcoholic Intoxication, Chronic 289
Disease Target Count P-value
ovarian cancer 8520 1.1e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 2.1
Disease Target Count Z-score Confidence
Differentiating neuroblastoma 2 3.491 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.1e-06

Gene RIF (21)

AA Sequence

MLRRVTVAAVCATRRKLCEAGRELAALWGIETRGRCEDSAAARPFPILAMPGRNKAKSTCSCPDLQPNGQ      1 - 70
DLGENSRVARLGADESEEEGRRGSLSNAGDPEIVKSPSDPKQYRYIKLQNGLQALLISDLSNMEGKTGNT     71 - 140
TDDEEEEEVEEEEDDDEDSGAEIEDDDEEGFDDEDEFDDEHDDDLDTEDNELEELEERAEARKKTTEKQS    141 - 210
AAALCVGVGSFADPDDLPGLAHFLEHMVFMGSLKYPDENGFDAFLKKHGGSDNASTDCERTVFQFDVQRK    211 - 280
YFKEALDRWAQFFIHPLMIRDAIDREVEAVDSEYQLARPSDANRKEMLFGSLARPGHPMGKFFWGNAETL    281 - 350
KHEPRKNNIDTHARLREFWMRYYSSHYMTLVVQSKETLDTLEKWVTEIFSQIPNNGLPRPNFGHLTDPFD    351 - 420
TPAFNKLYRVVPIRKIHALTITWALPPQQQHYRVKPLHYISWLVGHEGKGSILSFLRKKCWALALFGGNG    421 - 490
ETGFEQNSTYSVFSISITLTDEGYEHFYEVAYTVFQYLKMLQKLGPEKRIFEEIRKIEDNEFHYQEQTDP    491 - 560
VEYVENMCENMQLYPLQDILTGDQLLFEYKPEVIGEALNQLVPQKANLVLLSGANEGKCDLKEKWFGTQY    561 - 630
SIEDIENSWAELWNSNFELNPDLHLPAENKYIATDFTLKAFDCPETEYPVKIVNTPQGCLWYKKDNKFKI    631 - 700
PKAYIRFHLISPLIQKSAANVVLFDIFVNILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHKLP    701 - 770
LLFQLIIDYLAEFNSTPAVFTMITEQLKKTYFNILIKPETLAKDVRLLILEYARWSMIDKYQALMDGLSL    771 - 840
ESLLSFVKEFKSQLFVEGLVQGNVTSTESMDFLKYVVDKLNFKPLEQEMPVQFQVVELPSGHHLCKVKAL    841 - 910
NKGDANSEVTVYYQSGTRSLREYTLMELLVMHMEEPCFDFLRTKQTLGYHVYPTCRNTSGILGFSVTVGT    911 - 980
QATKYNSEVVDKKIEEFLSSFEEKIENLTEEAFNTQVTALIKLKECEDTHLGEEVDRNWNEVVTQQYLFD    981 - 1050
RLAHEIEALKSFSKSDLVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTS   1051 - 1120
PLLADCIIPITDIRAFTTTLNLLPYHKIVK                                           1121 - 1150
//

Text Mined References (38)

PMID Year Title