Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.89
PubTator Score 3.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 5.9e-07
psoriasis 6694 2.9e-05
Multiple myeloma 1332 1.8e-04
ovarian cancer 8520 1.8e-04
osteosarcoma 7950 9.4e-04
Waldenstrons macroglobulinemia 765 9.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 5.9e-07
Multiple myeloma 1.506 1.8e-04
osteosarcoma -1.049 9.4e-04
ovarian cancer 1.100 1.8e-04
psoriasis 1.800 2.9e-05
Waldenstrons macroglobulinemia 1.071 9.1e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEV      1 - 70
FKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFA     71 - 140
NVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGR    141 - 210
GKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNL    211 - 280
AAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVK    281 - 350
KVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS                                       351 - 385
//

Text Mined References (24)

PMID Year Title