Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MFFIHKKVHIGQTFGKYNEYEKACNNLAIIVQGITQVRQPTCCRKSDFSKHQQTHTGEKPHECVECEKPS      1 - 70
ISKSDLMIQHKMPTEEKPYACNCCEKLFSYKSSLTIHQRIHTGEKPYGCNECGKTVRCKSFLTLHQRTHT     71 - 140
GDKPYKCIECGKTFTVNQLLTLHHRTHSGEKPYQCSECGKTFSQKSYLTIHHRTHTWQKPYACDHCEKAF    141 - 210
SHKSKLTVHQRTHTGEKPYEYNECRKPFINKSNLRIHQRTHIREKPYECNECGKTFHQKSFLTVHQRTHR    211 - 280
RKKPYECNELGKTFHCKSFLTVHQKTHTGEKPYACNKCGKTYSHKS                            281 - 326
//

Text Mined References (2)

PMID Year Title
9337403 1997 Expressed sequences within pericentromeric heterochromatin of human chromosome 22.
1639391 1992 Cloning of six new genes with zinc finger motifs mapping to short and long arms of human acrocentric chromosome 22 (p and q11.2).