Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.07
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.3e-04
adult high grade glioma 2148 1.6e-03
Disease Target Count Z-score Confidence
Treacher Collins syndrome 29 3.087 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.105 2.3e-04
adult high grade glioma -1.100 1.6e-03

Gene RIF (6)

PMID Text
20141036 ZF5 downregulated the activity of 5'-regulatory region of FMR1 gene (acting probably through canonic 5'-GCGCGC3' sites).
17714511 data identify a new class of ZF5 targets, a subset of genes containing GCC-elements in their regulatory regions
16805315 GCC-elements are a novel class of ZF5 targets in 5'-regulatory regions of mammalian genes
15639979 Observational study of gene-disease association. (HuGE Navigator)
15629158 ZNF295 may be involved in the bi-directional control of gene expression in concert with ZFP161
14706637 transfection of ZFP161 induced dopamine transporter mRNA expression

AA Sequence

MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEV      1 - 70
DSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQS     71 - 140
KSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEV    141 - 210
RKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQ    211 - 280
ACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKK    281 - 350
HERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP    351 - 420
SAIQSETEQLQAAAMAAEAEQQLETIACS                                             421 - 449
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20141036 2009 [The role of ZF5 and CGGBP-20 transcription factors in expression regulation of human FMR1 gene responsible for X-fragile syndrome].
19299493 2009 Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.
17714511 2007 Novel repressor of the human FMR1 gene - identification of p56 human (GCC)(n)-binding protein as a Krüppel-like transcription factor ZF5.
16805315 2006 [Transcription factor ZF5 regulates expression of mammalian gene containing GCC-triplet repeats in 5'-regulatory region in human hepatoma HepG2 cells].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15639979 2004 [Variations of the zinc finger protein 161 gene in Chinese with or without high myopia].
15629158 2005 Novel human BTB/POZ domain-containing zinc finger protein ZNF295 is directly associated with ZFP161.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706637 2004 Human zinc finger protein 161, a novel transcriptional activator of the dopamine transporter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10080939 1999 ZF5, which is a Kruppel-type transcriptional repressor, requires the zinc finger domain for self-association.
10049742 1999 Analysis of the consensus binding sequence and the DNA-binding domain of ZF5.
9244432 1997 The human gene ZFP161 on 18p11.21-pter encodes a putative c-myc repressor and is homologous to murine Zfp161 (Chr 17) and Zfp161-rs1 (X Chr)
9177479 1997 Expression cloning and intracellular localization of a human ZF5 homologue.
8367294 1993 Transcriptional repressor ZF5 identifies a new conserved domain in zinc finger proteins.