Property Summary

NCBI Gene PubMed Count 16
PubMed Score 22.07
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.105 0.000
adult high grade glioma -1.100 0.002

Synonym

Accession O43829 O00403 Q2TB80
Symbols ZF5
ZFP-5
ZFP161
ZNF478
ZFP-161

Gene

Gene RIF (6)

PMID Text
20141036 ZF5 downregulated the activity of 5'-regulatory region of FMR1 gene (acting probably through canonic 5'-GCGCGC3' sites).
17714511 data identify a new class of ZF5 targets, a subset of genes containing GCC-elements in their regulatory regions
16805315 GCC-elements are a novel class of ZF5 targets in 5'-regulatory regions of mammalian genes
15639979 Observational study of gene-disease association. (HuGE Navigator)
15629158 ZNF295 may be involved in the bi-directional control of gene expression in concert with ZFP161
14706637 transfection of ZFP161 induced dopamine transporter mRNA expression

AA Sequence

MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEV      1 - 70
DSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQS     71 - 140
KSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEV    141 - 210
RKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQ    211 - 280
ACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKK    281 - 350
HERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP    351 - 420
SAIQSETEQLQAAAMAAEAEQQLETIACS                                             421 - 449
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20141036 2009 [The role of ZF5 and CGGBP-20 transcription factors in expression regulation of human FMR1 gene responsible for X-fragile syndrome].
19299493 2009 Biochemical and genetic evidence for a role of IGHMBP2 in the translational machinery.
17714511 2007 Novel repressor of the human FMR1 gene - identification of p56 human (GCC)(n)-binding protein as a Krüppel-like transcription factor ZF5.
16805315 2006 [Transcription factor ZF5 regulates expression of mammalian gene containing GCC-triplet repeats in 5'-regulatory region in human hepatoma HepG2 cells].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15639979 2004 [Variations of the zinc finger protein 161 gene in Chinese with or without high myopia].
15629158 2005 Novel human BTB/POZ domain-containing zinc finger protein ZNF295 is directly associated with ZFP161.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14706637 2004 Human zinc finger protein 161, a novel transcriptional activator of the dopamine transporter.
More...