Property Summary

NCBI Gene PubMed Count 18
PubMed Score 23.53
PubTator Score 13.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.900 0.021
lung adenocarcinoma -1.300 0.000
Breast cancer -1.800 0.000

Gene RIF (5)

PMID Text
25854806 ANGPTL7 is markedly down regulated in metastatic liver cancer.
25622036 ANGPTL7, which is abundantly expressed in keratocytes, plays a major role in maintaining corneal avascularity and transparency.
24903490 Angiopoietin-like 7 is a novel pro-angiogenetic factor over-expressed in cancer
21199193 Together with previous findings, these properties strengthen ANGPTL7's candidacy for the regulation of intraocular pressure and glaucoma.
18421092 Induction of ANGPTL7 secretion by glaucoma stimuli and increased concentration of ANGPTL7 in glaucomatous AH suggest that ANGPTL7 is overexpressed in glaucoma.

AA Sequence

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ      1 - 70
ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR     71 - 140
ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH    141 - 210
RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN    211 - 280
CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP        281 - 346
//

Text Mined References (19)

PMID Year Title
25854806 2015 Cd11b(+) myeloid cells support hepatic metastasis through down-regulation of angiopoietin-like 7 in cancer cells.
25622036 2015 Angiopoietin-like 7 is an anti-angiogenic protein required to prevent vascularization of the cornea.
24903490 2014 Angiopoietin-like 7, a novel pro-angiogenetic factor over-expressed in cancer.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21199193 2011 Evidence for a role of angiopoietin-like 7 (ANGPTL7) in extracellular matrix formation of the human trabecular meshwork: implications for glaucoma.
18421092 2008 Angiopoietin-like 7 secretion is induced by glaucoma stimuli and its concentration is elevated in glaucomatous aqueous humor.
17695521 Effect of CDT6 on factors of angiogenic balance in tumour cell lines.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...