Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.32
PubTator Score 13.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3577 7.2e-94
lung adenocarcinoma 2716 7.9e-17
psoriasis 6694 2.1e-02
Disease Target Count Z-score Confidence
Glaucoma 239 3.626 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.800 7.2e-94
lung adenocarcinoma -1.200 7.9e-17
psoriasis -1.900 2.1e-02

Gene RIF (6)

AA Sequence

MLKKPLSAVTWLCIFIVAFVSHPAWLQKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQ      1 - 70
ERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYR     71 - 140
ISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIH    141 - 210
RLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDN    211 - 280
CLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP        281 - 346
//

Text Mined References (21)

PMID Year Title