Property Summary

Ligand Count 6
NCBI Gene PubMed Count 53
PubMed Score 0.00
PubTator Score 83.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Gene RIF (17)

AA Sequence

MAAQGYGYYRTVIFSAMFGGYSLYYFNRKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVL      1 - 70
SDQMSARWLFSSGLLLVGLVNIFFAWSSTVPVFAALWFLNGLAQGLGWPPCGKVLRKWFEPSQFGTWWAI     71 - 140
LSTSMNLAGGLGPILATILAQSYSWRSTLALSGALCVVVSFLCLLLIHNEPADVGLRNLDPMPSEGKKGS    141 - 210
LKEESTLQELLLSPYLWVLSTGYLVVFGVKTCCTDWGQFFLIQEKGQSALVGSSYMSALEVGGLVGSIAA    211 - 280
GYLSDRAMAKAGLSNYGNPRHGLLLFMMAGMTVSMYLFRVTVTSDSPKLWILVLGAVFGFSSYGPIALFG    281 - 350
VIANESAPPNLCGTSHAIVGLMANVGGFLAGLPFSTIAKHYSWSTAFWVAEVICAASTAAFFLLRNIRTK    351 - 420
MGRVSKKAE                                                                 421 - 429
//

Text Mined References (55)

PMID Year Title