Property Summary

NCBI Gene PubMed Count 31
Grant Count 6
R01 Count 6
Funding $638,530.5
PubMed Score 22.58
PubTator Score 22.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -2.538 0.000
tuberculosis and treatment for 6 months 1.200 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.002
lung cancer 1.200 0.003
ovarian cancer 1.300 0.000

Synonym

Accession O43823 AKAP-8
Symbols AKAP-8
AKAP95
AKAP 95
AKAP-95

Gene

Gene RIF (9)

PMID Text
26823747 Report expression of connexin 43 in ovarian cancer cells in G1/S phase.
26683827 The data indicate that AKAP95 is a novel nucleolus-associated protein with a regulatory role on rRNA production.
26076356 Gene dosage at 19p13.12, and AKAP8 and/or AKAP8L in particular, play an important role in modulation of head size and may contribute to autism risk.
25770215 These results suggest that AKAP8 is involved in the regulation of chromatin structural changes through nuclear tyrosine phosphorylation.
23995757 Ectopic AKAP95 stimulates expression of a chromosomal reporter gene in synergy with MLL1 or MLL2, whereas AKAP95 depletion impairs retinoic acid-mediated gene induction in embryonic stem cells
22944692 Positional proteomics analysis identifies the cleavage of human A kinase (PRKA) anchor protein 8 (AKAP8) at amino acid residues 310-311 by the HIV-1 protease
16227597 AKAP95 is a potential carrier protein for active caspase 3 from the cytoplasm into the nuclei in apoptotic cells.
12740381 role of AKAP95 in DNA replication by providing a scaffold for MCM2
12414807 AMY-1 interacts with S-AKAP84 and this protein in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.

AA Sequence

MDQGYGGYGAWSAGPANTQGAYGTGVASWQGYENYNYYGAQNTSVTTGATYSYGPASWEAAKANDGGLAA      1 - 70
GAPAMHMASYGPEPCTDNSDSLIAKINQRLDMMSKEGGRGGSGGGGEGIQDRESSFRFQPFESYDSRPCL     71 - 140
PEHNPYRPSYSYDYEFDLGSDRNGSFGGQYSECRDPARERGSLDGFMRGRGQGRFQDRSNPGTFMRSDPF    141 - 210
VPPAASSEPLSTPWNELNYVGGRGLGGPSPSRPPPSLFSQSMAPDYGVMGMQGAGGYDSTMPYGCGRSQP    211 - 280
RMRDRDRPKRRGFDRFGPDGTGRKRKQFQLYEEPDTKLARVDSEGDFSENDDAAGDFRSGDEEFKGEDEL    281 - 350
CDSGRQRGEKEDEDEDVKKRREKQRRRDRTRDRAADRIQFACSVCKFRSFDDEEIQKHLQSKFHKETLRF    351 - 420
ISTKLPDKTVEFLQEYIVNRNKKIEKRRQELMEKETAKPKPDPFKGIGQEHFFKKIEAAHCLACDMLIPA    421 - 490
QPQLLQRHLHSVDHNHNRRLAAEQFKKTSLHVAKSVLNNRHIVKMLEKYLKGEDPFTSETVDPEMEGDDN    491 - 560
LGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVP    561 - 630
CGTAHEKGVPKARSEAAEAGNGAETMAAEAESAQTRVAPAPAAADAEVEQTDAESKDAVPTE            631 - 692
//

Text Mined References (45)

PMID Year Title
26880274 2016 Dynamic changes in protein interaction between AKAP95 and Cx43 during cell cycle progression of A549 cells.
26823747 2015 Roles of Cx43 and AKAP95 in ovarian cancer tissues in G1/S phase.
26683827 2016 A-kinase anchoring protein AKAP95 is a novel regulator of ribosomal RNA synthesis.
26076356 2015 Reciprocal Relationship between Head Size, an Autism Endophenotype, and Gene Dosage at 19p13.12 Points to AKAP8 and AKAP8L.
25770215 2015 Role for Tyrosine Phosphorylation of A-kinase Anchoring Protein 8 (AKAP8) in Its Dissociation from Chromatin and the Nuclear Matrix.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23995757 2013 Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...