Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.91
PubTator Score 7.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.177 6.1e-05
psoriasis -1.500 1.2e-04

Gene RIF (7)

AA Sequence

MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLR      1 - 70
RNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEE     71 - 140
ITAAPEREGTGHGGPKLCCTLSSLSSAAETGRDPLDSEEEATSGAQDERGLKPPSRGQFPSLSARDASSS    141 - 210
HRGRNVLTAILLLLRELDAEGLEAVQQTVGSRLQALRGEEVQEHAE                            211 - 256
//

Text Mined References (20)

PMID Year Title