Property Summary

NCBI Gene PubMed Count 56
PubMed Score 152.82
PubTator Score 132.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
cytochrome-c oxidase deficiency disease 19 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Heart disease 306 4.151 2.1
Lactic acidosis 51 3.228 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis 2.000 6.7e-04
cutaneous lupus erythematosus 2.100 2.9e-03
interstitial cystitis 1.300 1.9e-03
intraductal papillary-mucinous neoplasm ... 1.200 8.8e-03
juvenile dermatomyositis 1.878 1.1e-12
lung adenocarcinoma 1.200 7.7e-09
lung cancer -1.500 4.3e-04
malignant mesothelioma -1.100 1.9e-05
ovarian cancer 3.300 6.6e-08
psoriasis 1.500 1.1e-07
tuberculosis 2.400 1.6e-05

 GO Function (1)

Gene RIF (38)

AA Sequence

MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAG      1 - 70
LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDE     71 - 140
LEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYN    141 - 210
AGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS                  211 - 266
//

Text Mined References (59)

PMID Year Title