Property Summary

NCBI Gene PubMed Count 51
Grant Count 18
R01 Count 12
Funding $1,946,119.01
PubMed Score 144.34
PubTator Score 132.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 3.300 0.000
cutaneous lupus erythematosus 2.100 0.003
juvenile dermatomyositis 1.878 0.000
Atopic dermatitis 2.000 0.001
tuberculosis 2.400 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.009
lung cancer -1.500 0.000
interstitial cystitis 1.300 0.002
lung adenocarcinoma 1.200 0.000
ovarian cancer 3.300 0.000

 GO Function (1)

Gene RIF (35)

PMID Text
26700591 Geranylgeranoic acid increased the SCO2 gene expression, which might enhance aerobic respiration.
26351686 Sco1 is a metallochaperone that selectively transfers Cu(I) ions based on loop recognition, whereas Sco2 is a copper-dependent thiol reductase of the cysteine ligands in the oxidase.
26309161 oncoprotein HBXIP enhances glucose metabolism reprogramming through suppressing SCO2 and PDHA1 in breast cancer
25959673 Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies.
25720770 Letter/Case Report: SCO2 mutations resulting in Leigh disease revealed at autopsy.
25525168 mutation in LRPAP1 is associated with high myopia. Further studies are expected to evaluate the pathogenicity of the variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2.
24403053 COX20 cooperates with SCO1 and SCO2 to mature COX2 and promote the assembly of cytochrome c oxidase.
23786650 alpha-particle-induced bystander effect is regulated by p53 and its downstream SCO2 in the irradiated hepatoma cells
23643385 Mutations in SCO2 are associated with autosomal-dominant high-grade myopia.
23612020 oroxylin A could increase protein and mRNA expression of TP53-induced glycolysis and apoptosis regulator (TIGAR) and synthesis of cytochrome c oxidase 2 (SCO2), which are the key metabolic modulators regulated by p53.
More...

AA Sequence

MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAG      1 - 70
LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDE     71 - 140
LEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYN    141 - 210
AGPKDEDQDYIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS                  211 - 266
//

Text Mined References (54)

PMID Year Title
26741492 2016 A Comprehensive Genomic Analysis Reveals the Genetic Landscape of Mitochondrial Respiratory Chain Complex Deficiencies.
26700591 2015 Upregulation of energy metabolism-related, p53-target TIGAR and SCO2 in HuH-7 cells with p53 mutation by geranylgeranoic acid treatment.
26351686 2015 Loop recognition and copper-mediated disulfide reduction underpin metal site assembly of CuA in human cytochrome oxidase.
26309161 2015 The oncoprotein HBXIP promotes glucose metabolism reprogramming via downregulating SCO2 and PDHA1 in breast cancer.
25959673 2015 Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25720770 2015 Leigh disease due to SCO2 mutations revealed at extended autopsy.
25525168 2014 Detection of mutations in LRPAP1, CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2 in 298 families with early-onset high myopia by exome sequencing.
24403053 2014 Human COX20 cooperates with SCO1 and SCO2 to mature COX2 and promote the assembly of cytochrome c oxidase.
23786650 2013 Alpha particle-induced bystander effect is mediated by ROS via a p53-dependent SCO2 pathway in hepatoma cells.
More...