Property Summary

NCBI Gene PubMed Count 16
PubMed Score 8.59
PubTator Score 5.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
medulloblastoma, large-cell 1.600 0.001

Synonym

Accession O43818 B2R996 Q8IZ30
Symbols U3-55K
RNU3IP2

Gene

PDB

4J0W   4JXM  

 GO Function (1)

 GO Process (1)

Gene RIF (3)

PMID Text
21505065 Data show that U3 snoRNP assembly, and therefore U3 snoRNA accumulation, is regulated through the U3-specific protein hU3-55K.
19333934 the frequencies of African American race and male sex are greater among systemic sclerosis patients with anti-U3 RNP antibody than those without
12032086 Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments.

AA Sequence

MSATAAARKRGKPASGAGAGAGAGKRRRKADSAGDRGKSKGGGKMNEEISSDSESESLAPRKPEEEEEEE      1 - 70
LEETAQEKKLRLAKLYLEQLRQQEEEKAEARAFEEDQVAGRLKEDVLEQRGRLQKLVAKEIQAPASADIR     71 - 140
VLRGHQLSITCLVVTPDDSAIFSAAKDCSIIKWSVESGRKLHVIPRAKKGAEGKPPGHSSHVLCMAISSD    141 - 210
GKYLASGDRSKLILIWEAQSCQHLYTFTGHRDAVSGLAFRRGTHQLYSTSHDRSVKVWNVAENSYVETLF    211 - 280
GHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALW    281 - 350
GLSKKRPLALQREAHGLRGEPGLEQPFWISSVAALLNTDLVATGSHSSCVRLWQCGEGFRQLDLLCDIPL    351 - 420
VGFINSLKFSSSGDFLVAGVGQEHRLGRWWRIKEARNSVCIIPLRRVPVPPAAGS                   421 - 475
//

Text Mined References (22)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21505065 2011 A weak C' box renders U3 snoRNA levels dependent on hU3-55K binding.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19333934 2009 Anti-U3 RNP autoantibodies in systemic sclerosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...