Property Summary

NCBI Gene PubMed Count 32
PubMed Score 51.05
PubTator Score 22.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.70370891847673E-13
atypical teratoid / rhabdoid tumor 4369 1.30024055948937E-6
acute quadriplegic myopathy 1157 8.73807645799695E-6
osteosarcoma 7933 1.87284528017349E-5
ovarian cancer 8492 3.05298042409069E-5
medulloblastoma, large-cell 6234 1.42413493012572E-4
glioblastoma 5572 5.64044276052455E-4
cystic fibrosis 1670 0.00109713311199964
pediatric high grade glioma 2712 0.00117515315863518
pancreatic cancer 2300 0.00147835211090388
primary pancreatic ductal adenocarcinoma 1271 0.00411635836713527
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00465708381533789
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00507169930997369
spina bifida 1064 0.0204150929272082
ependymoma 2514 0.0276119642067846
gastric carcinoma 832 0.0293586097097769
progressive supranuclear palsy 674 0.0361895871227466
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0464152813865062
astrocytic glioma 2241 0.0468939007520094
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 27 4.727 2.4

Expression

Synonym

Accession O43815 Q3KP65 Q53TQ8 Q9NP38
Symbols SG2NA
PPP2R6A

Gene

  Ortholog (12)

Gene RIF (11)

PMID Text
25501894 the "multimodulator" scaffold roles of striatins in the initiation and regulation of the formation of various complex particles and structures, are discussed.
25497017 PP2A/striatin complex modulates microtubule dynamics by regulating MAP2 phosphorylation
25368024 the rapid, nongenomic mineralocorticoid receptor pathway (mediated via striatin) has a role in modulating the interaction between salt intake and blood pressure.
24613930 Our data demonstrate that STRN-ALK fusion occurs in a subset of patients with highly aggressive types of thyroid cancer and provide initial evidence suggesting that it may represent a therapeutic target for these patients.
24475247 A recurrent STRN/ALK fusion found in thyroid carcinomas.
21985334 Striatin orchestrates the regulation of Mst3 by PP2A.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19023099 Observational study of gene-disease association. (HuGE Navigator)
18571342 Taken together, splicing variation of SG2NA might have some critical roles in differentiation and maturation in metazoan cells.
17975119 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQW      1 - 70
EVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEG     71 - 140
NETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVVNGTE    141 - 210
AEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRD    211 - 280
TKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPN    281 - 350
RSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESE    351 - 420
LGLGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMW    421 - 490
NLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSV    491 - 560
LRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHM    561 - 630
VASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIH    631 - 700
SMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASA    701 - 770
GADALAKVFV                                                                771 - 780
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501894 2015 Striatins as plaque molecules of zonulae adhaerentes in simple epithelia, of tessellate junctions in stratified epithelia, of cardiac composite junctions and of various size classes of lateral adherens junctions in cultures of epithelia- and carcinoma-derived cells.
25497017 2015 Downregulation of striatin leads to hyperphosphorylation of MAP2, induces depolymerization of microtubules and inhibits proliferation of HEK293T cells.
25416956 2014 A proteome-scale map of the human interactome network.
25368024 2015 Variants in striatin gene are associated with salt-sensitive blood pressure in mice and humans.
24613930 2014 Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.
24475247 2014 Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...