Property Summary

NCBI Gene PubMed Count 36
PubMed Score 58.50
PubTator Score 22.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.070 8.7e-06
adult high grade glioma -1.200 2.0e-03
astrocytic glioma -1.200 4.7e-02
atypical teratoid / rhabdoid tumor -1.700 1.3e-06
cystic fibrosis -1.300 1.1e-03
ependymoma -1.400 4.5e-02
gastric carcinoma 1.100 2.9e-02
glioblastoma -1.500 5.6e-04
intraductal papillary-mucinous adenoma (... 1.700 4.7e-03
intraductal papillary-mucinous carcinoma... 1.100 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.700 4.6e-02
juvenile dermatomyositis 1.826 7.7e-13
medulloblastoma, large-cell -1.100 1.6e-02
osteosarcoma -1.182 1.9e-05
ovarian cancer -1.500 3.1e-05
pancreatic cancer 1.200 1.5e-03
primary pancreatic ductal adenocarcinoma 1.022 4.1e-03
progressive supranuclear palsy -1.100 3.6e-02
spina bifida -1.454 3.8e-02

Gene RIF (14)

AA Sequence

MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQW      1 - 70
EVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEG     71 - 140
NETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVVNGTE    141 - 210
AEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRD    211 - 280
TKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPN    281 - 350
RSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESE    351 - 420
LGLGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMW    421 - 490
NLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSV    491 - 560
LRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHM    561 - 630
VASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIH    631 - 700
SMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASA    701 - 770
GADALAKVFV                                                                771 - 780
//

Text Mined References (44)

PMID Year Title