Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNE      1 - 70
RSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQI     71 - 140
WFQNRRARHRGQSGRAPTQASIRCNAAPIG                                            141 - 170
//

Text Mined References (4)

PMID Year Title