Property Summary

NCBI Gene PubMed Count 39
PubMed Score 34.02
PubTator Score 9.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.289 5.6e-08
Alzheimer's disease -1.400 3.3e-02
atypical teratoid / rhabdoid tumor 1.600 5.3e-06
Breast cancer 2.300 4.8e-02
ependymoma 1.100 2.4e-07
Gaucher disease type 1 -1.100 4.9e-03
glioblastoma 1.400 7.5e-07
group 4 medulloblastoma 1.400 1.4e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.1e-02
juvenile dermatomyositis 1.060 4.0e-07
malignant mesothelioma 1.100 6.4e-06
medulloblastoma, large-cell 1.900 2.8e-05
non-small cell lung cancer 1.192 6.4e-20
ovarian cancer -1.200 1.7e-02
pediatric high grade glioma 1.400 8.5e-06
Pick disease -1.500 8.7e-05
primitive neuroectodermal tumor 1.200 3.9e-04
psoriasis -2.300 6.6e-05

Protein-protein Interaction (1)

PDB (11)

Gene RIF (13)

AA Sequence

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE      1 - 70
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV     71 - 140
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP    141 - 210
IISSLPQLLSRFNFIYN                                                         211 - 227
//

Text Mined References (46)

PMID Year Title