Property Summary

NCBI Gene PubMed Count 36
PubMed Score 28.80
PubTator Score 9.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.37000919665452E-20
ependymoma 2514 2.35231058595817E-7
juvenile dermatomyositis 1189 4.00700489277187E-7
glioblastoma 5572 2.31825212230212E-6
primitive neuroectodermal tumor 3031 3.65942402870785E-6
atypical teratoid / rhabdoid tumor 4369 5.34368871181887E-6
malignant mesothelioma 3163 6.37160443652348E-6
pediatric high grade glioma 2712 8.49329380399788E-6
medulloblastoma, large-cell 6234 6.21693554126664E-5
psoriasis 6685 6.6155279090767E-5
group 4 medulloblastoma 1875 6.75657920541569E-5
Pick disease 1893 8.70679339038595E-5
acute quadriplegic myopathy 1157 9.72257453141575E-5
ovarian cancer 8492 1.80680246046417E-4
Gaucher disease type 1 171 0.00488483199443274
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.010840505146456
Alzheimer's disease 644 0.0326270196219056
Breast cancer 3099 0.0482690292425466
Disease Target Count Z-score Confidence
Amebiasis 22 3.96 2.0

Expression

  Differential Expression (18)

Synonym

Accession O43809 Q6IB85 Q6NE84
Symbols CPSF5
CFIM25

Gene

PDB

2CL3   2J8Q   3BAP   3BHO   3MDG   3MDI   3N9U   3P5T   3P6Y   3Q2S   3Q2T  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
26312503 The authors identify NUDT21 as a novel candidate for intellectual disability and neuropsychiatric disease, and elucidate a mechanism of pathogenesis by MeCP2 dysregulation via altered alternative polyadenylation.
23125841 Tandem affinity purification and mass spectrometry analysis identify cleavage and polyadenylation specificity factor 5 (CPSF5; NUDT21), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21295486 Structure of a CFI(m)25/CFI(m)68 RRM heterotetramer and biochemical data indicated that CFIm25 specifically recognized two UGUA elements, CFIm68 facilitates looping of the intervening RNA. CFIm-mediated RNA looping may regulate alternative polyadnylation.
21295486 Crystal structure of CFIm25-CFIm68 RRM heterotetramer illustrated that CFIm25 homodimer is clamped by two CFIm68 monomers on each side of the dimer interface.
20695905 Data provide evidence that CFIm exists as a heterotetramer of 25-kD, 59-kD and 68-kD subunits of CFIm: CFIm25, CFIm59 and CFIm68.
20479262 crystal structures of the CFI(m)25 homodimer in complex with UGUAAA and UUGUAU RNA sequences
20479262 Crystallographic and biochemical experiments suggest that CF I(m)25 specifically recognizes UGUA RNA sequence and binds to two UGUA simultaneously
18767156 The crystal structure of human CPSF5 was solved at 1.9 A resolution.
18445629 Results from crystallographic and biochemical experiments suggest that CF I(m)25 makes use of its Nudix fold to bind but not hydrolyze ATP and diadenosine tetraphosphate.
17098938 Evidence that CFIm25 regulates alternative poly(A) site selection of genes with tandem poly(A) signals in their 3'-UTRs.
More...

AA Sequence

MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREE      1 - 70
FDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWV     71 - 140
IDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP    141 - 210
IISSLPQLLSRFNFIYN                                                         211 - 227
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26312503 2015 NUDT21-spanning CNVs lead to neuropsychiatric disease and altered MeCP2 abundance via alternative polyadenylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22960638 2012 Alternative 3'-end processing of long noncoding RNA initiates construction of nuclear paraspeckles.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...