Property Summary

NCBI Gene PubMed Count 20
PubMed Score 108.62
PubTator Score 9.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 1.5e-08
lung cancer 1.400 2.1e-03

Gene RIF (4)

AA Sequence

MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFP      1 - 70
VISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNED     71 - 140
IVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGA    141 - 210
VAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLT    211 - 280
AALMFLVYEKLTAATFTVMGLKRAHQH                                               281 - 307
//

Text Mined References (20)

PMID Year Title