Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
R01 Count 7
Funding $1,317,922.32
PubMed Score 106.17
PubTator Score 9.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.600 0.000
lung cancer 1.400 0.002

Gene RIF (4)

PMID Text
25002403 PEX16 mediates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
22185573 SLC25A17 is a transporter for CoA and FAD, and to a lesser extent NAD
12445829 Results describe the identification of PMP34, a peroxisomal membrane protein belonging to the mitochondrial solute carrier family, as an adenine nucleotide transporter.

AA Sequence

MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFP      1 - 70
VISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNED     71 - 140
IVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGA    141 - 210
VAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLT    211 - 280
AALMFLVYEKLTAATFTVMGLKRAHQH                                               281 - 307
//

Text Mined References (20)

PMID Year Title
25002403 2014 PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22185573 2012 The human gene SLC25A17 encodes a peroxisomal transporter of coenzyme A, FAD and NAD+.
21153762 2011 The role of a microfinance program on HIV risk behavior among Haitian women.
20171429 2010 [In vitro comparison of the efficacy and photostability of three sunscreen creams].
19946888 2010 Defining the membrane proteome of NK cells.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...