Property Summary

NCBI Gene PubMed Count 18
PubMed Score 57.59
PubTator Score 120.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.600 0.001

Synonym

Accession O43805 Q5VSG0 Q6FG70 Q9BVW8
Symbols N14
NA14
NA-14

Gene

Gene RIF (2)

PMID Text
25390646 NA14 may act as an adaptor protein regulating SPG4 localization to centrosomes, temporally and spatially regulating the microtubule-severing activity of SPG4 that is particularly critical during the cell cycle and neuronal development.
22008182 purification and characterization of NA14 and some variants; NA14 structure may be stabilized by two Glu-COO(-) ||| HO-Tyr H-bonds, highly conserved in NA14-like proteins in other species

AA Sequence

MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNE      1 - 70
FDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS                          71 - 119
//

Text Mined References (22)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25390646 2014 Spastin-interacting protein NA14/SSNA1 functions in cytokinesis and axon development.
22008182 2011 Characterization of the structure and self-recognition of the human centrosomal protein NA14: implications for stability and function.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...